BLASTX nr result
ID: Zanthoxylum22_contig00038360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00038360 (365 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006446030.1| hypothetical protein CICLE_v10014934mg [Citr... 67 4e-09 ref|XP_006446029.1| hypothetical protein CICLE_v10014934mg [Citr... 67 4e-09 gb|KDO64855.1| hypothetical protein CISIN_1g010127mg [Citrus sin... 67 5e-09 ref|XP_006493661.1| PREDICTED: uncharacterized protein LOC102624... 67 5e-09 >ref|XP_006446030.1| hypothetical protein CICLE_v10014934mg [Citrus clementina] gi|557548641|gb|ESR59270.1| hypothetical protein CICLE_v10014934mg [Citrus clementina] Length = 517 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 123 FRTMASPPPRRLWSSFARPSHPVSRRKLAWVSLEGRLVNAE 1 FR+M SP PRRL S+F RPS PVSRR LAWVSLEGRL+NAE Sbjct: 35 FRSMPSPSPRRLSSNFTRPSEPVSRRNLAWVSLEGRLMNAE 75 >ref|XP_006446029.1| hypothetical protein CICLE_v10014934mg [Citrus clementina] gi|557548640|gb|ESR59269.1| hypothetical protein CICLE_v10014934mg [Citrus clementina] Length = 516 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 123 FRTMASPPPRRLWSSFARPSHPVSRRKLAWVSLEGRLVNAE 1 FR+M SP PRRL S+F RPS PVSRR LAWVSLEGRL+NAE Sbjct: 35 FRSMPSPSPRRLSSNFTRPSEPVSRRNLAWVSLEGRLMNAE 75 >gb|KDO64855.1| hypothetical protein CISIN_1g010127mg [Citrus sinensis] Length = 517 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 123 FRTMASPPPRRLWSSFARPSHPVSRRKLAWVSLEGRLVNAE 1 FR+M SP PRRL S+F RPS PVSRR LAWVSLEGRLVNA+ Sbjct: 35 FRSMPSPSPRRLSSNFKRPSEPVSRRNLAWVSLEGRLVNAD 75 >ref|XP_006493661.1| PREDICTED: uncharacterized protein LOC102624964 [Citrus sinensis] gi|641845971|gb|KDO64856.1| hypothetical protein CISIN_1g010127mg [Citrus sinensis] Length = 516 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 123 FRTMASPPPRRLWSSFARPSHPVSRRKLAWVSLEGRLVNAE 1 FR+M SP PRRL S+F RPS PVSRR LAWVSLEGRLVNA+ Sbjct: 35 FRSMPSPSPRRLSSNFKRPSEPVSRRNLAWVSLEGRLVNAD 75