BLASTX nr result
ID: Zanthoxylum22_contig00038198
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00038198 (428 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO41725.1| hypothetical protein CISIN_1g036786mg [Citrus sin... 64 4e-08 ref|XP_008353574.1| PREDICTED: frataxin, mitochondrial-like [Mal... 57 4e-06 gb|ABN08486.1| Frataxin-like [Medicago truncatula] 57 4e-06 ref|XP_012479773.1| PREDICTED: frataxin, mitochondrial [Gossypiu... 57 5e-06 gb|KHF99641.1| Frataxin, mitochondrial -like protein [Gossypium ... 57 5e-06 ref|XP_006447426.1| hypothetical protein CICLE_v10016814mg [Citr... 57 7e-06 ref|XP_007043410.1| Frataxin [Theobroma cacao] gi|508707345|gb|E... 57 7e-06 ref|XP_009788901.1| PREDICTED: frataxin, mitochondrial isoform X... 56 9e-06 >gb|KDO41725.1| hypothetical protein CISIN_1g036786mg [Citrus sinensis] Length = 158 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 426 NEVLSLKVGALGTYVSNKQTPNRQIWLSS*VRYY 325 NEVL+LK+GALGTYV NKQTPNRQIWLSS VRYY Sbjct: 120 NEVLTLKLGALGTYVLNKQTPNRQIWLSSPVRYY 153 >ref|XP_008353574.1| PREDICTED: frataxin, mitochondrial-like [Malus domestica] Length = 235 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 426 NEVLSLKVGALGTYVSNKQTPNRQIWLSS*VRYYFR 319 NEVL+LK+G GTYV NKQTPNRQIWLSS VRY R Sbjct: 123 NEVLTLKLGDHGTYVLNKQTPNRQIWLSSPVRYVVR 158 >gb|ABN08486.1| Frataxin-like [Medicago truncatula] Length = 155 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -3 Query: 426 NEVLSLKVGALGTYVSNKQTPNRQIWLSS*VRYY 325 N+VL++K+G LGTYV NKQTPNRQ+WLSS VRY+ Sbjct: 115 NDVLTVKLGELGTYVLNKQTPNRQLWLSSPVRYF 148 >ref|XP_012479773.1| PREDICTED: frataxin, mitochondrial [Gossypium raimondii] gi|763764506|gb|KJB31760.1| hypothetical protein B456_005G207400 [Gossypium raimondii] Length = 190 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 426 NEVLSLKVGALGTYVSNKQTPNRQIWLSS 340 NEVL+LK+GALGTYV NKQTPNRQIWLSS Sbjct: 117 NEVLTLKLGALGTYVMNKQTPNRQIWLSS 145 >gb|KHF99641.1| Frataxin, mitochondrial -like protein [Gossypium arboreum] Length = 190 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 426 NEVLSLKVGALGTYVSNKQTPNRQIWLSS 340 NEVL+LK+GALGTYV NKQTPNRQIWLSS Sbjct: 117 NEVLTLKLGALGTYVMNKQTPNRQIWLSS 145 >ref|XP_006447426.1| hypothetical protein CICLE_v10016814mg [Citrus clementina] gi|567910227|ref|XP_006447427.1| hypothetical protein CICLE_v10016814mg [Citrus clementina] gi|567910229|ref|XP_006447428.1| hypothetical protein CICLE_v10016814mg [Citrus clementina] gi|568831055|ref|XP_006469796.1| PREDICTED: frataxin, mitochondrial-like isoform X1 [Citrus sinensis] gi|568831057|ref|XP_006469797.1| PREDICTED: frataxin, mitochondrial-like isoform X2 [Citrus sinensis] gi|568831059|ref|XP_006469798.1| PREDICTED: frataxin, mitochondrial-like isoform X3 [Citrus sinensis] gi|557550037|gb|ESR60666.1| hypothetical protein CICLE_v10016814mg [Citrus clementina] gi|557550038|gb|ESR60667.1| hypothetical protein CICLE_v10016814mg [Citrus clementina] gi|557550039|gb|ESR60668.1| hypothetical protein CICLE_v10016814mg [Citrus clementina] Length = 196 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 426 NEVLSLKVGALGTYVSNKQTPNRQIWLSS 340 NEVL+LK+GALGTYV NKQTPNRQIWLSS Sbjct: 120 NEVLTLKLGALGTYVLNKQTPNRQIWLSS 148 >ref|XP_007043410.1| Frataxin [Theobroma cacao] gi|508707345|gb|EOX99241.1| Frataxin [Theobroma cacao] Length = 184 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 426 NEVLSLKVGALGTYVSNKQTPNRQIWLSS 340 NEVL+LK+GALGTYV NKQTPNRQIWLSS Sbjct: 111 NEVLTLKLGALGTYVLNKQTPNRQIWLSS 139 >ref|XP_009788901.1| PREDICTED: frataxin, mitochondrial isoform X2 [Nicotiana sylvestris] Length = 164 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 426 NEVLSLKVGALGTYVSNKQTPNRQIWLSS*VR 331 NEVL+LK+G LGTYV NKQTPNRQIW+SS VR Sbjct: 129 NEVLTLKLGGLGTYVINKQTPNRQIWMSSPVR 160