BLASTX nr result
ID: Zanthoxylum22_contig00038070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00038070 (268 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010665799.1| PREDICTED: aspartate aminotransferase, chlor... 53 1e-05 >ref|XP_010665799.1| PREDICTED: aspartate aminotransferase, chloroplastic [Beta vulgaris subsp. vulgaris] Length = 459 Score = 52.8 bits (125), Expect(2) = 1e-05 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 146 KYLST*GLAEFNKVTAELLFGADNPLLKEQRLL*TRTMFSCG 21 +YL GLA FNKVTAELLFGADNP+LKEQR+ +++ G Sbjct: 121 EYLPIEGLAAFNKVTAELLFGADNPVLKEQRVATVQSLSGTG 162 Score = 23.1 bits (48), Expect(2) = 1e-05 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -1 Query: 43 LEQCFPAAKVLISS 2 +E+ FP AKVLISS Sbjct: 171 IERYFPGAKVLISS 184