BLASTX nr result
ID: Zanthoxylum22_contig00037931
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00037931 (278 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007674443.1| hypothetical protein BAUCODRAFT_32282 [Baudo... 62 1e-07 ref|XP_007922567.1| hypothetical protein MYCFIDRAFT_52829 [Pseud... 62 2e-07 dbj|GAM90631.1| hypothetical protein ANO11243_086760 [fungal sp.... 60 5e-07 gb|EME47630.1| hypothetical protein DOTSEDRAFT_69547 [Dothistrom... 57 5e-06 >ref|XP_007674443.1| hypothetical protein BAUCODRAFT_32282 [Baudoinia panamericana UAMH 10762] gi|449302260|gb|EMC98269.1| hypothetical protein BAUCODRAFT_32282 [Baudoinia panamericana UAMH 10762] Length = 904 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 276 DKWESPVFSIGSAKESSNLPAVSKPARKPHNVT 178 DKWESPVFSIGSAKESSNLP +S+P R+PH+VT Sbjct: 737 DKWESPVFSIGSAKESSNLPKISEPKRRPHDVT 769 >ref|XP_007922567.1| hypothetical protein MYCFIDRAFT_52829 [Pseudocercospora fijiensis CIRAD86] gi|452985976|gb|EME85732.1| hypothetical protein MYCFIDRAFT_52829 [Pseudocercospora fijiensis CIRAD86] Length = 878 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 276 DKWESPVFSIGSAKESSNLPAVSKPARKPHNVT 178 DKWESPVFSIGSAKESS LP+VS+P RKPH VT Sbjct: 787 DKWESPVFSIGSAKESSGLPSVSRPTRKPHAVT 819 >dbj|GAM90631.1| hypothetical protein ANO11243_086760 [fungal sp. No.11243] Length = 989 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 276 DKWESPVFSIGSAKESSNLPAVSKPARKPHNVTPMELKP 160 DKWESP+FSIGSAKES+NLP + +RKPHN T L+P Sbjct: 775 DKWESPIFSIGSAKESTNLPRAQEISRKPHNATQASLQP 813 >gb|EME47630.1| hypothetical protein DOTSEDRAFT_69547 [Dothistroma septosporum NZE10] Length = 917 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 276 DKWESPVFSIGSAKESSNLPAVSKPARKPHN 184 DKWESPVFSIGSA+ESSNL +VS+P RKPH+ Sbjct: 783 DKWESPVFSIGSARESSNLASVSEPRRKPHS 813