BLASTX nr result
ID: Zanthoxylum22_contig00037927
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00037927 (356 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010096483.1| hypothetical protein L484_017935 [Morus nota... 100 5e-19 >ref|XP_010096483.1| hypothetical protein L484_017935 [Morus notabilis] gi|587875494|gb|EXB64603.1| hypothetical protein L484_017935 [Morus notabilis] Length = 486 Score = 100 bits (248), Expect = 5e-19 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 299 ERQLYWHATYTGTRTLSKAKSTSYT*ELLRIGNEADSHHYHKTSDQLM 156 ERQLYWHATYTGTRTLSKAKSTSYT ELLRIGNEADSHHYHKTSDQLM Sbjct: 313 ERQLYWHATYTGTRTLSKAKSTSYTLELLRIGNEADSHHYHKTSDQLM 360