BLASTX nr result
ID: Zanthoxylum22_contig00037880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00037880 (454 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006437388.1| hypothetical protein CICLE_v10031987mg [Citr... 82 2e-13 >ref|XP_006437388.1| hypothetical protein CICLE_v10031987mg [Citrus clementina] gi|568862486|ref|XP_006484714.1| PREDICTED: uncharacterized protein LOC102611599 [Citrus sinensis] gi|557539584|gb|ESR50628.1| hypothetical protein CICLE_v10031987mg [Citrus clementina] gi|641823174|gb|KDO42611.1| hypothetical protein CISIN_1g019146mg [Citrus sinensis] Length = 345 Score = 82.0 bits (201), Expect = 2e-13 Identities = 43/60 (71%), Positives = 46/60 (76%) Frame = -1 Query: 181 MHRSSSHKLLREEFASCFSPVVRLSYNKCRSSYSIGVLVGDCCNWRTYSTYNLLGSGSEK 2 MHRSS K LREEFASC S +V+ SYNKCRSSY IGVLV DC N RTY T+NLL GS K Sbjct: 1 MHRSSP-KFLREEFASCVSLIVQPSYNKCRSSYRIGVLVADCSNSRTYCTHNLLEPGSVK 59