BLASTX nr result
ID: Zanthoxylum22_contig00037752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00037752 (337 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007039851.1| Histidine triad nucleotide-binding 4 isoform... 64 3e-08 emb|CDP09959.1| unnamed protein product [Coffea canephora] 62 1e-07 ref|XP_012475927.1| PREDICTED: histidine triad nucleotide-bindin... 61 3e-07 ref|XP_012475928.1| PREDICTED: histidine triad nucleotide-bindin... 61 3e-07 gb|KDO61458.1| hypothetical protein CISIN_1g034907mg [Citrus sin... 61 3e-07 ref|XP_006440325.1| hypothetical protein CICLE_v10022693mg [Citr... 61 3e-07 gb|KHG02111.1| Histidine triad nucleotide-binding 3 [Gossypium a... 60 8e-07 ref|XP_006477204.1| PREDICTED: histidine triad nucleotide-bindin... 60 8e-07 ref|XP_006477202.1| PREDICTED: histidine triad nucleotide-bindin... 60 8e-07 ref|XP_010542223.1| PREDICTED: histidine triad nucleotide-bindin... 59 1e-06 ref|XP_010542200.1| PREDICTED: histidine triad nucleotide-bindin... 59 1e-06 ref|XP_010542199.1| PREDICTED: histidine triad nucleotide-bindin... 59 1e-06 ref|XP_010542198.1| PREDICTED: uncharacterized protein LOC104815... 59 1e-06 ref|XP_009627004.1| PREDICTED: histidine triad nucleotide-bindin... 59 1e-06 ref|XP_011070122.1| PREDICTED: histidine triad nucleotide-bindin... 56 9e-06 ref|XP_010542201.1| PREDICTED: histidine triad nucleotide-bindin... 56 9e-06 >ref|XP_007039851.1| Histidine triad nucleotide-binding 4 isoform 1 [Theobroma cacao] gi|508777096|gb|EOY24352.1| Histidine triad nucleotide-binding 4 isoform 1 [Theobroma cacao] Length = 151 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -2 Query: 336 WKCVKYLSLGPLGGFIEAEKLLEKIKPLSPISS 238 WK VKYLSLGPLGGFIEAEKLLEKIKPLSPI S Sbjct: 119 WKHVKYLSLGPLGGFIEAEKLLEKIKPLSPIPS 151 >emb|CDP09959.1| unnamed protein product [Coffea canephora] Length = 189 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 336 WKCVKYLSLGPLGGFIEAEKLLEKIKPLSPISS 238 WK +KYLSLGPLGGFI+AEKLLEK+KPLSP++S Sbjct: 157 WKSIKYLSLGPLGGFIKAEKLLEKLKPLSPLTS 189 >ref|XP_012475927.1| PREDICTED: histidine triad nucleotide-binding protein 3 isoform X1 [Gossypium raimondii] Length = 152 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 336 WKCVKYLSLGPLGGFIEAEKLLEKIKPLSPI 244 WK +KY+SLGPLGGFIEAEKLLEKIKPLSPI Sbjct: 120 WKQLKYMSLGPLGGFIEAEKLLEKIKPLSPI 150 >ref|XP_012475928.1| PREDICTED: histidine triad nucleotide-binding protein 3 isoform X2 [Gossypium raimondii] gi|763758025|gb|KJB25356.1| hypothetical protein B456_004G199000 [Gossypium raimondii] gi|763758026|gb|KJB25357.1| hypothetical protein B456_004G199000 [Gossypium raimondii] Length = 148 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 336 WKCVKYLSLGPLGGFIEAEKLLEKIKPLSPI 244 WK +KY+SLGPLGGFIEAEKLLEKIKPLSPI Sbjct: 116 WKQLKYMSLGPLGGFIEAEKLLEKIKPLSPI 146 >gb|KDO61458.1| hypothetical protein CISIN_1g034907mg [Citrus sinensis] gi|641842554|gb|KDO61459.1| hypothetical protein CISIN_1g034907mg [Citrus sinensis] Length = 79 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -2 Query: 336 WKCVKYLSLGPLGGFIEAEKLLEKIKPLSPISS 238 WK VKYLSLGPLGGFIEAEKLLEKIKPLS SS Sbjct: 47 WKHVKYLSLGPLGGFIEAEKLLEKIKPLSSTSS 79 >ref|XP_006440325.1| hypothetical protein CICLE_v10022693mg [Citrus clementina] gi|557542587|gb|ESR53565.1| hypothetical protein CICLE_v10022693mg [Citrus clementina] Length = 150 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -2 Query: 336 WKCVKYLSLGPLGGFIEAEKLLEKIKPLSPISS 238 WK VKYLSLGPLGGFIEAEKLLEKIKPLS SS Sbjct: 118 WKHVKYLSLGPLGGFIEAEKLLEKIKPLSSTSS 150 >gb|KHG02111.1| Histidine triad nucleotide-binding 3 [Gossypium arboreum] Length = 148 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 336 WKCVKYLSLGPLGGFIEAEKLLEKIKPLSPI 244 WK +KY+SLGPLGGFIEAEKLLEKIKP SPI Sbjct: 116 WKQLKYMSLGPLGGFIEAEKLLEKIKPFSPI 146 >ref|XP_006477204.1| PREDICTED: histidine triad nucleotide-binding protein 3-like isoform X3 [Citrus sinensis] Length = 125 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -2 Query: 336 WKCVKYLSLGPLGGFIEAEKLLEKIKPLSPISS 238 WK VKYLSLGPLGGFIEAEKLLEKIKP S SS Sbjct: 93 WKHVKYLSLGPLGGFIEAEKLLEKIKPFSSTSS 125 >ref|XP_006477202.1| PREDICTED: histidine triad nucleotide-binding protein 3-like isoform X1 [Citrus sinensis] gi|568846744|ref|XP_006477203.1| PREDICTED: histidine triad nucleotide-binding protein 3-like isoform X2 [Citrus sinensis] Length = 150 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -2 Query: 336 WKCVKYLSLGPLGGFIEAEKLLEKIKPLSPISS 238 WK VKYLSLGPLGGFIEAEKLLEKIKP S SS Sbjct: 118 WKHVKYLSLGPLGGFIEAEKLLEKIKPFSSTSS 150 >ref|XP_010542223.1| PREDICTED: histidine triad nucleotide-binding protein 3-like [Tarenaya hassleriana] Length = 151 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 336 WKCVKYLSLGPLGGFIEAEKLLEKIKPLSPISS*ILDC 223 WK +KY SLGPLGGFIEAE LLEK+KPLS + S DC Sbjct: 77 WKAIKYKSLGPLGGFIEAEALLEKLKPLSSLPSKATDC 114 >ref|XP_010542200.1| PREDICTED: histidine triad nucleotide-binding protein 3-like isoform X3 [Tarenaya hassleriana] Length = 182 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 336 WKCVKYLSLGPLGGFIEAEKLLEKIKPLSPISS*ILDC 223 WK +KY SLGPLGGFIEAE LLEK+KPLS + S DC Sbjct: 115 WKAIKYKSLGPLGGFIEAEALLEKLKPLSSLPSKATDC 152 >ref|XP_010542199.1| PREDICTED: histidine triad nucleotide-binding protein 3-like isoform X2 [Tarenaya hassleriana] Length = 232 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 336 WKCVKYLSLGPLGGFIEAEKLLEKIKPLSPISS*ILDC 223 WK +KY SLGPLGGFIEAE LLEK+KPLS + S DC Sbjct: 115 WKAIKYKSLGPLGGFIEAEALLEKLKPLSSLPSKATDC 152 >ref|XP_010542198.1| PREDICTED: uncharacterized protein LOC104815489 isoform X1 [Tarenaya hassleriana] Length = 267 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 336 WKCVKYLSLGPLGGFIEAEKLLEKIKPLSPISS*ILDC 223 WK +KY SLGPLGGFIEAE LLEK+KPLS + S DC Sbjct: 115 WKAIKYKSLGPLGGFIEAEALLEKLKPLSSLPSKATDC 152 >ref|XP_009627004.1| PREDICTED: histidine triad nucleotide-binding protein 3 [Nicotiana tomentosiformis] Length = 162 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 336 WKCVKYLSLGPLGGFIEAEKLLEKIKPLSP 247 W+C+KYLSLGPLGGFIEAEKLLE+IKP P Sbjct: 128 WRCIKYLSLGPLGGFIEAEKLLERIKPQIP 157 >ref|XP_011070122.1| PREDICTED: histidine triad nucleotide-binding protein 3 isoform X2 [Sesamum indicum] gi|747048244|ref|XP_011070123.1| PREDICTED: histidine triad nucleotide-binding protein 3 isoform X2 [Sesamum indicum] Length = 123 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 336 WKCVKYLSLGPLGGFIEAEKLLEKIKPLSPI 244 WK +KYLSLGP GGFIEAEKLLE+IKP+S + Sbjct: 93 WKAIKYLSLGPFGGFIEAEKLLERIKPVSSL 123 >ref|XP_010542201.1| PREDICTED: histidine triad nucleotide-binding protein 3-like isoform X4 [Tarenaya hassleriana] Length = 152 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -2 Query: 336 WKCVKYLSLGPLGGFIEAEKLLEKIKPLSPISS*IL 229 WK +KY SLGPLGGFIEAE LLEK+KPLS + S +L Sbjct: 115 WKAIKYKSLGPLGGFIEAEALLEKLKPLSSLPSKML 150