BLASTX nr result
ID: Zanthoxylum22_contig00037724
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00037724 (361 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO79612.1| hypothetical protein CISIN_1g012782mg [Citrus sin... 109 7e-22 ref|XP_006450549.1| hypothetical protein CICLE_v10008244mg [Citr... 109 7e-22 ref|XP_006450548.1| hypothetical protein CICLE_v10008244mg [Citr... 109 7e-22 ref|XP_002532784.1| pentatricopeptide repeat-containing protein,... 84 4e-14 ref|XP_007048731.1| Pentatricopeptide repeat superfamily protein... 83 9e-14 ref|XP_007048729.1| Pentatricopeptide repeat superfamily protein... 83 9e-14 ref|XP_007048728.1| Pentatricopeptide repeat superfamily protein... 83 9e-14 ref|XP_009766478.1| PREDICTED: putative pentatricopeptide repeat... 80 8e-13 ref|XP_009766475.1| PREDICTED: putative pentatricopeptide repeat... 80 8e-13 ref|XP_009599852.1| PREDICTED: putative pentatricopeptide repeat... 80 8e-13 emb|CBI26532.3| unnamed protein product [Vitis vinifera] 79 1e-12 ref|XP_002274300.1| PREDICTED: putative pentatricopeptide repeat... 79 1e-12 ref|XP_010323680.1| PREDICTED: putative pentatricopeptide repeat... 79 1e-12 ref|XP_004243786.1| PREDICTED: putative pentatricopeptide repeat... 79 1e-12 gb|KNA19232.1| hypothetical protein SOVF_063290 [Spinacia oleracea] 79 2e-12 ref|XP_011075861.1| PREDICTED: putative pentatricopeptide repeat... 79 2e-12 ref|XP_009790968.1| PREDICTED: putative pentatricopeptide repeat... 78 3e-12 ref|XP_009593769.1| PREDICTED: putative pentatricopeptide repeat... 78 3e-12 ref|XP_006348886.1| PREDICTED: putative pentatricopeptide repeat... 77 4e-12 ref|XP_012464407.1| PREDICTED: putative pentatricopeptide repeat... 77 7e-12 >gb|KDO79612.1| hypothetical protein CISIN_1g012782mg [Citrus sinensis] Length = 410 Score = 109 bits (273), Expect = 7e-22 Identities = 56/82 (68%), Positives = 63/82 (76%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 HA+ VF+SM +KDSFTYSSMVHNLC SG++I+KSAQKAVVDGLR Sbjct: 329 HAINVFESMEVKDSFTYSSMVHNLCKAKRLPSASKLLLSCLKSGVRILKSAQKAVVDGLR 388 Query: 179 HSGCRREAKKIQSKIRMAKMSH 114 HSGCRREAKKIQSKIRMAK+SH Sbjct: 389 HSGCRREAKKIQSKIRMAKISH 410 >ref|XP_006450549.1| hypothetical protein CICLE_v10008244mg [Citrus clementina] gi|557553775|gb|ESR63789.1| hypothetical protein CICLE_v10008244mg [Citrus clementina] gi|641860925|gb|KDO79613.1| hypothetical protein CISIN_1g012782mg [Citrus sinensis] Length = 319 Score = 109 bits (273), Expect = 7e-22 Identities = 56/82 (68%), Positives = 63/82 (76%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 HA+ VF+SM +KDSFTYSSMVHNLC SG++I+KSAQKAVVDGLR Sbjct: 238 HAINVFESMEVKDSFTYSSMVHNLCKAKRLPSASKLLLSCLKSGVRILKSAQKAVVDGLR 297 Query: 179 HSGCRREAKKIQSKIRMAKMSH 114 HSGCRREAKKIQSKIRMAK+SH Sbjct: 298 HSGCRREAKKIQSKIRMAKISH 319 >ref|XP_006450548.1| hypothetical protein CICLE_v10008244mg [Citrus clementina] gi|568844658|ref|XP_006476201.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform X1 [Citrus sinensis] gi|568844660|ref|XP_006476202.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform X2 [Citrus sinensis] gi|568844662|ref|XP_006476203.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform X3 [Citrus sinensis] gi|557553774|gb|ESR63788.1| hypothetical protein CICLE_v10008244mg [Citrus clementina] gi|641860921|gb|KDO79609.1| hypothetical protein CISIN_1g012782mg [Citrus sinensis] gi|641860922|gb|KDO79610.1| hypothetical protein CISIN_1g012782mg [Citrus sinensis] gi|641860923|gb|KDO79611.1| hypothetical protein CISIN_1g012782mg [Citrus sinensis] Length = 456 Score = 109 bits (273), Expect = 7e-22 Identities = 56/82 (68%), Positives = 63/82 (76%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 HA+ VF+SM +KDSFTYSSMVHNLC SG++I+KSAQKAVVDGLR Sbjct: 375 HAINVFESMEVKDSFTYSSMVHNLCKAKRLPSASKLLLSCLKSGVRILKSAQKAVVDGLR 434 Query: 179 HSGCRREAKKIQSKIRMAKMSH 114 HSGCRREAKKIQSKIRMAK+SH Sbjct: 435 HSGCRREAKKIQSKIRMAKISH 456 >ref|XP_002532784.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527472|gb|EEF29603.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 487 Score = 84.0 bits (206), Expect = 4e-14 Identities = 40/82 (48%), Positives = 58/82 (70%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 HA+ +F+SM ++DSFTYSS+VHNLC SGMKI+ SAQ+ V+ GLR Sbjct: 405 HAVKLFESMKMRDSFTYSSLVHNLCKNGRFHRASKLLLSCLRSGMKILPSAQRVVISGLR 464 Query: 179 HSGCRREAKKIQSKIRMAKMSH 114 +SG ++EA+K++SKI++A+M H Sbjct: 465 YSGFQKEARKLKSKIKLARMLH 486 >ref|XP_007048731.1| Pentatricopeptide repeat superfamily protein, putative isoform 4 [Theobroma cacao] gi|590710091|ref|XP_007048732.1| Pentatricopeptide repeat superfamily protein, putative isoform 4 [Theobroma cacao] gi|508700992|gb|EOX92888.1| Pentatricopeptide repeat superfamily protein, putative isoform 4 [Theobroma cacao] gi|508700993|gb|EOX92889.1| Pentatricopeptide repeat superfamily protein, putative isoform 4 [Theobroma cacao] Length = 490 Score = 82.8 bits (203), Expect = 9e-14 Identities = 43/80 (53%), Positives = 56/80 (70%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 +AM VF SM ++DSFTYSS+VHNLC SGMKI+KSAQ+AV+ GLR Sbjct: 408 NAMKVFKSMEVRDSFTYSSLVHNLCRAGRYRSASKLLLSCLRSGMKILKSAQRAVLSGLR 467 Query: 179 HSGCRREAKKIQSKIRMAKM 120 +SG EA+K+QSKIR+A++ Sbjct: 468 YSGFPGEARKVQSKIRIARI 487 >ref|XP_007048729.1| Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] gi|590710083|ref|XP_007048730.1| Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] gi|508700990|gb|EOX92886.1| Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] gi|508700991|gb|EOX92887.1| Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] Length = 457 Score = 82.8 bits (203), Expect = 9e-14 Identities = 43/80 (53%), Positives = 56/80 (70%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 +AM VF SM ++DSFTYSS+VHNLC SGMKI+KSAQ+AV+ GLR Sbjct: 375 NAMKVFKSMEVRDSFTYSSLVHNLCRAGRYRSASKLLLSCLRSGMKILKSAQRAVLSGLR 434 Query: 179 HSGCRREAKKIQSKIRMAKM 120 +SG EA+K+QSKIR+A++ Sbjct: 435 YSGFPGEARKVQSKIRIARI 454 >ref|XP_007048728.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|508700989|gb|EOX92885.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] Length = 505 Score = 82.8 bits (203), Expect = 9e-14 Identities = 43/80 (53%), Positives = 56/80 (70%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 +AM VF SM ++DSFTYSS+VHNLC SGMKI+KSAQ+AV+ GLR Sbjct: 423 NAMKVFKSMEVRDSFTYSSLVHNLCRAGRYRSASKLLLSCLRSGMKILKSAQRAVLSGLR 482 Query: 179 HSGCRREAKKIQSKIRMAKM 120 +SG EA+K+QSKIR+A++ Sbjct: 483 YSGFPGEARKVQSKIRIARI 502 >ref|XP_009766478.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X2 [Nicotiana sylvestris] Length = 390 Score = 79.7 bits (195), Expect = 8e-13 Identities = 39/82 (47%), Positives = 54/82 (65%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 HA+ +F+SM +KDS TYS++VH LC GM+I+KS ++ VVDGLR Sbjct: 308 HALQMFESMDVKDSVTYSTIVHGLCKAGRFRAASKLLLSCIRGGMRILKSDKRFVVDGLR 367 Query: 179 HSGCRREAKKIQSKIRMAKMSH 114 SG +EA+K+QSKIR+AK+ H Sbjct: 368 SSGLSQEARKVQSKIRLAKILH 389 >ref|XP_009766475.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Nicotiana sylvestris] gi|698542643|ref|XP_009766476.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Nicotiana sylvestris] gi|698542646|ref|XP_009766477.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Nicotiana sylvestris] Length = 460 Score = 79.7 bits (195), Expect = 8e-13 Identities = 39/82 (47%), Positives = 54/82 (65%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 HA+ +F+SM +KDS TYS++VH LC GM+I+KS ++ VVDGLR Sbjct: 378 HALQMFESMDVKDSVTYSTIVHGLCKAGRFRAASKLLLSCIRGGMRILKSDKRFVVDGLR 437 Query: 179 HSGCRREAKKIQSKIRMAKMSH 114 SG +EA+K+QSKIR+AK+ H Sbjct: 438 SSGLSQEARKVQSKIRLAKILH 459 >ref|XP_009599852.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tomentosiformis] Length = 460 Score = 79.7 bits (195), Expect = 8e-13 Identities = 39/82 (47%), Positives = 54/82 (65%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 HA+ +F+SM +KDS TYS++VH LC GM+I+KS ++ VVDGLR Sbjct: 378 HALQMFESMDVKDSVTYSTIVHGLCKAGRFRAASKLLLSCIRGGMRILKSDKRFVVDGLR 437 Query: 179 HSGCRREAKKIQSKIRMAKMSH 114 SG +EA+K+QSKIR+AK+ H Sbjct: 438 SSGLSQEARKVQSKIRLAKILH 459 >emb|CBI26532.3| unnamed protein product [Vitis vinifera] Length = 441 Score = 79.3 bits (194), Expect = 1e-12 Identities = 38/82 (46%), Positives = 55/82 (67%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 HA+ +F SM +KDSFTYSSMVHNLC GMKI+++ Q++V+DGL Sbjct: 359 HAIKMFASMEVKDSFTYSSMVHNLCKARRYRHASRLLLACLRGGMKILRANQRSVIDGLC 418 Query: 179 HSGCRREAKKIQSKIRMAKMSH 114 +SG EA++++SKIR+A++ H Sbjct: 419 YSGYTSEARRLKSKIRLARILH 440 >ref|XP_002274300.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Vitis vinifera] gi|731422462|ref|XP_010662116.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Vitis vinifera] gi|731422464|ref|XP_010662117.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Vitis vinifera] gi|731422466|ref|XP_010662118.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Vitis vinifera] gi|731422469|ref|XP_010662119.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Vitis vinifera] Length = 457 Score = 79.3 bits (194), Expect = 1e-12 Identities = 38/82 (46%), Positives = 55/82 (67%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 HA+ +F SM +KDSFTYSSMVHNLC GMKI+++ Q++V+DGL Sbjct: 375 HAIKMFASMEVKDSFTYSSMVHNLCKARRYRHASRLLLACLRGGMKILRANQRSVIDGLC 434 Query: 179 HSGCRREAKKIQSKIRMAKMSH 114 +SG EA++++SKIR+A++ H Sbjct: 435 YSGYTSEARRLKSKIRLARILH 456 >ref|XP_010323680.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X2 [Solanum lycopersicum] Length = 402 Score = 79.0 bits (193), Expect = 1e-12 Identities = 40/80 (50%), Positives = 53/80 (66%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 HA+ +F+SM KDS TYS+MVH+LC GM+I+KS ++ V+DGLR Sbjct: 320 HALRMFESMDAKDSITYSTMVHSLCNARRFRAASKLLLSCIRGGMRILKSDKRGVIDGLR 379 Query: 179 HSGCRREAKKIQSKIRMAKM 120 SG +EAKKIQSKIR+AK+ Sbjct: 380 GSGYSQEAKKIQSKIRLAKI 399 >ref|XP_004243786.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Solanum lycopersicum] gi|723714891|ref|XP_010323676.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Solanum lycopersicum] gi|723714894|ref|XP_010323677.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Solanum lycopersicum] gi|723714899|ref|XP_010323678.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Solanum lycopersicum] gi|723714902|ref|XP_010323679.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Solanum lycopersicum] Length = 460 Score = 79.0 bits (193), Expect = 1e-12 Identities = 40/80 (50%), Positives = 53/80 (66%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 HA+ +F+SM KDS TYS+MVH+LC GM+I+KS ++ V+DGLR Sbjct: 378 HALRMFESMDAKDSITYSTMVHSLCNARRFRAASKLLLSCIRGGMRILKSDKRGVIDGLR 437 Query: 179 HSGCRREAKKIQSKIRMAKM 120 SG +EAKKIQSKIR+AK+ Sbjct: 438 GSGYSQEAKKIQSKIRLAKI 457 >gb|KNA19232.1| hypothetical protein SOVF_063290 [Spinacia oleracea] Length = 447 Score = 78.6 bits (192), Expect = 2e-12 Identities = 41/79 (51%), Positives = 50/79 (63%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 HAM +F M +KD FTYSSMVHNLC +GM I++SA++AV+ G R Sbjct: 353 HAMNIFKLMKMKDEFTYSSMVHNLCKERKFRSASRILLSCLKNGMNILESAERAVIRGFR 412 Query: 179 HSGCRREAKKIQSKIRMAK 123 SG RR A K+QSKIRMAK Sbjct: 413 ASGLRRGATKLQSKIRMAK 431 >ref|XP_011075861.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Sesamum indicum] gi|747059007|ref|XP_011075862.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Sesamum indicum] gi|747059009|ref|XP_011075863.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Sesamum indicum] gi|747059011|ref|XP_011075864.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Sesamum indicum] gi|747059013|ref|XP_011075865.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Sesamum indicum] Length = 456 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/82 (46%), Positives = 54/82 (65%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 +A+ +F S+ +KDSFTYSS+VHNLC +GMK++KS QKAV+ GL Sbjct: 374 YALKIFHSVDVKDSFTYSSLVHNLCKARRYRLAAELLLSCIKAGMKVLKSDQKAVIKGLT 433 Query: 179 HSGCRREAKKIQSKIRMAKMSH 114 +G +R+AKK + KIR+AK+ H Sbjct: 434 LTGSKRDAKKFELKIRIAKLLH 455 >ref|XP_009790968.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana sylvestris] gi|698488763|ref|XP_009790969.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana sylvestris] gi|698488765|ref|XP_009790970.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana sylvestris] gi|698488768|ref|XP_009790971.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana sylvestris] gi|698488770|ref|XP_009790973.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana sylvestris] Length = 460 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/82 (46%), Positives = 52/82 (63%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 HA+ +F+SM KDSFTYS++VH LC GM+I+KS ++ V+ GLR Sbjct: 378 HALRMFESMDAKDSFTYSTIVHGLCKAGRFCAASKLLLSCVRDGMRILKSNKRVVISGLR 437 Query: 179 HSGCRREAKKIQSKIRMAKMSH 114 SG EA+K+QSKIR+AK+ H Sbjct: 438 SSGFSHEARKVQSKIRLAKILH 459 >ref|XP_009593769.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tomentosiformis] gi|697169740|ref|XP_009593770.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tomentosiformis] gi|697169742|ref|XP_009593771.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tomentosiformis] gi|697169744|ref|XP_009593772.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tomentosiformis] gi|697169746|ref|XP_009593773.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tomentosiformis] gi|697169748|ref|XP_009593774.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tomentosiformis] gi|697169750|ref|XP_009593776.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tomentosiformis] gi|697169752|ref|XP_009593777.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tomentosiformis] Length = 460 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/82 (46%), Positives = 52/82 (63%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 HA+ +F+SM KDSFTYS++VH LC GM+I+KS ++ V+ GLR Sbjct: 378 HALQMFESMDAKDSFTYSTIVHGLCKAGRFRAASKLLLSCVRGGMRILKSNKRVVITGLR 437 Query: 179 HSGCRREAKKIQSKIRMAKMSH 114 SG EA+K+QSKIR+AK+ H Sbjct: 438 SSGFSHEARKVQSKIRLAKILH 459 >ref|XP_006348886.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Solanum tuberosum] Length = 460 Score = 77.4 bits (189), Expect = 4e-12 Identities = 38/82 (46%), Positives = 53/82 (64%) Frame = -3 Query: 359 HAMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLR 180 HA+ +F+SM KDS TYS+MVH+LC GM+I+KS ++ V+DGLR Sbjct: 378 HALRMFESMDAKDSITYSTMVHSLCNARRFRAASKLLLSCIRGGMRILKSDKRGVIDGLR 437 Query: 179 HSGCRREAKKIQSKIRMAKMSH 114 SG +EA+K+QSKIR+A + H Sbjct: 438 GSGYSQEARKVQSKIRLATILH 459 >ref|XP_012464407.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X3 [Gossypium raimondii] Length = 369 Score = 76.6 bits (187), Expect = 7e-12 Identities = 40/79 (50%), Positives = 56/79 (70%) Frame = -3 Query: 356 AMVVFDSMPIKDSFTYSSMVHNLCXXXXXXXXXXXXXXXXXSGMKIIKSAQKAVVDGLRH 177 A+ V+ SM ++DSFTYSS+V+NLC SGMKI+KSAQ+AV+ GLR+ Sbjct: 288 AIKVYKSMEVRDSFTYSSLVYNLCRDRRYHSAAKLLLSCLRSGMKILKSAQRAVLLGLRY 347 Query: 176 SGCRREAKKIQSKIRMAKM 120 SG REAK+++SKIR+A++ Sbjct: 348 SGFPREAKRLKSKIRIARI 366