BLASTX nr result
ID: Zanthoxylum22_contig00037400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00037400 (347 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHG20851.1| Zinc finger A20 and AN1 domain-containing stress-... 59 2e-06 >gb|KHG20851.1| Zinc finger A20 and AN1 domain-containing stress-associated 7 -like protein [Gossypium arboreum] Length = 218 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +1 Query: 244 KTGKQNMGSEQSDGTSYSPSESKLCANGCGFFGT 345 +T K+ MGSEQ++GTS+ PSE KLCANGCGFFGT Sbjct: 42 QTRKEIMGSEQNEGTSFPPSEPKLCANGCGFFGT 75