BLASTX nr result
ID: Zanthoxylum22_contig00037362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00037362 (397 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006453554.1| hypothetical protein CICLE_v10007906mg [Citr... 62 2e-07 >ref|XP_006453554.1| hypothetical protein CICLE_v10007906mg [Citrus clementina] gi|557556780|gb|ESR66794.1| hypothetical protein CICLE_v10007906mg [Citrus clementina] Length = 414 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = -3 Query: 395 GFGSEHISREAPSPSSGTRTLCSLSFEDLIFFPFLPSFYRYSFSF 261 G GSE +SREAPSPSSGTRT+CSLS E L+F+PF F F F Sbjct: 329 GIGSEQMSREAPSPSSGTRTICSLSSEVLMFYPFFAKFLLLQFFF 373