BLASTX nr result
ID: Zanthoxylum22_contig00037313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00037313 (408 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006477995.1| PREDICTED: uncharacterized serine-rich prote... 60 8e-07 ref|XP_006441028.1| hypothetical protein CICLE_v10020533mg [Citr... 60 8e-07 >ref|XP_006477995.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Citrus sinensis] gi|641816759|gb|KDO38559.1| hypothetical protein CISIN_1g016512mg [Citrus sinensis] Length = 388 Score = 59.7 bits (143), Expect = 8e-07 Identities = 30/38 (78%), Positives = 30/38 (78%), Gaps = 5/38 (13%) Frame = +3 Query: 306 MASACVNNNIG-----FSSYGWLSPRISFSCEEDPSKK 404 MASACVNNNIG F SYGWL PRISFS EEDPSKK Sbjct: 1 MASACVNNNIGVSPEKFPSYGWLGPRISFSREEDPSKK 38 >ref|XP_006441028.1| hypothetical protein CICLE_v10020533mg [Citrus clementina] gi|557543290|gb|ESR54268.1| hypothetical protein CICLE_v10020533mg [Citrus clementina] Length = 389 Score = 59.7 bits (143), Expect = 8e-07 Identities = 30/38 (78%), Positives = 30/38 (78%), Gaps = 5/38 (13%) Frame = +3 Query: 306 MASACVNNNIG-----FSSYGWLSPRISFSCEEDPSKK 404 MASACVNNNIG F SYGWL PRISFS EEDPSKK Sbjct: 1 MASACVNNNIGVSPEKFPSYGWLGPRISFSREEDPSKK 38