BLASTX nr result
ID: Zanthoxylum22_contig00037308
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00037308 (474 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010789890.1| PREDICTED: ataxin-2 homolog [Notothenia cori... 56 1e-06 >ref|XP_010789890.1| PREDICTED: ataxin-2 homolog [Notothenia coriiceps] Length = 665 Score = 55.8 bits (133), Expect(2) = 1e-06 Identities = 37/122 (30%), Positives = 50/122 (40%), Gaps = 1/122 (0%) Frame = -3 Query: 364 HQQPHQIQVTEQNPNPRQNQNHAKPQTWTIVK*AQNTQTPIQYLRLTYHQQHSSNQHNKN 185 HQ+PHQ Q Q+P P Q+Q +L H QH H+K Sbjct: 183 HQEPHQHQEPHQHPEPHQHQE--------------------PHLHQEPHHQHQETHHHKE 222 Query: 184 DHSRHQ-NRSKHPQRRTPIQH**TDQPPHCQT*Q*KIDHSPDFHRPQLHQQLKENGHHH* 8 H RH ++ H Q + P QH Q PH Q + + P H+ + HQQ + HH Sbjct: 223 THHRHHLHQEPHHQHQKPHQH----QEPHHQHQEPHLHQDPHQHQ-EPHQQYHLHQEHHH 277 Query: 7 NH 2 H Sbjct: 278 QH 279 Score = 23.1 bits (48), Expect(2) = 1e-06 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 405 PKHQQPHQNQQ 373 P+HQ+PHQ Q Sbjct: 174 PQHQEPHQQHQ 184