BLASTX nr result
ID: Zanthoxylum22_contig00037269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00037269 (579 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KGN48407.1| hypothetical protein Csa_6G486800 [Cucumis sativus] 64 4e-08 gb|KRH41562.1| hypothetical protein GLYMA_08G038000 [Glycine max] 62 3e-07 ref|XP_006381970.1| hypothetical protein POPTR_0006s22590g, part... 59 1e-06 gb|KCW62444.1| hypothetical protein EUGRSUZ_H05083 [Eucalyptus g... 57 5e-06 >gb|KGN48407.1| hypothetical protein Csa_6G486800 [Cucumis sativus] Length = 118 Score = 64.3 bits (155), Expect = 4e-08 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +1 Query: 121 LKVSDIQGRIKTAQALKPGESESS*AATANVLRNKPLK 234 ++VSDIQGRIKTA+ALKPGE ESS AATANVLRNKP K Sbjct: 60 VRVSDIQGRIKTAEALKPGEGESSQAATANVLRNKPYK 97 >gb|KRH41562.1| hypothetical protein GLYMA_08G038000 [Glycine max] Length = 88 Score = 61.6 bits (148), Expect = 3e-07 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 135 HPRKDKNSTSSQAWRKRKLLGSHCECFEKQAFEIVIINLH 254 HPRKD +S SS AWR+RKLLG HCEC EKQA +II ++ Sbjct: 38 HPRKDNSSISSLAWRRRKLLGGHCECLEKQALGFIIIGVN 77 >ref|XP_006381970.1| hypothetical protein POPTR_0006s22590g, partial [Populus trichocarpa] gi|550336872|gb|ERP59767.1| hypothetical protein POPTR_0006s22590g, partial [Populus trichocarpa] Length = 73 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +3 Query: 147 DKNSTSSQAWRKRKLLGSHCECFEKQAFEIVIINL 251 DK+S +QAWR+RK LG HCECFEKQAFE +II+L Sbjct: 1 DKSSMRTQAWRRRKHLGGHCECFEKQAFEFIIIDL 35 >gb|KCW62444.1| hypothetical protein EUGRSUZ_H05083 [Eucalyptus grandis] Length = 125 Score = 57.4 bits (137), Expect = 5e-06 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +1 Query: 127 VSDIQGRIKTAQALKPGESESS*AATANVLRNKPLKL 237 VSDIQGRIK A ALKPGE +SS AATANVLRNKP L Sbjct: 2 VSDIQGRIKAALALKPGEGKSSQAATANVLRNKPSSL 38