BLASTX nr result
ID: Zanthoxylum22_contig00037176
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00037176 (367 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006491189.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_006444949.1| hypothetical protein CICLE_v100190671mg, par... 62 1e-07 ref|XP_012843784.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-07 ref|XP_011092997.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-07 gb|EYU32173.1| hypothetical protein MIMGU_mgv1a002389mg [Erythra... 60 5e-07 ref|XP_012083305.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_009341118.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_008356925.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_008354009.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_008344990.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_007220199.1| hypothetical protein PRUPE_ppa003068mg [Prun... 59 1e-06 emb|CDP08758.1| unnamed protein product [Coffea canephora] 58 2e-06 ref|XP_009350326.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_009366564.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_007051704.1| Pentatricopeptide repeat superfamily protein... 58 3e-06 ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 ref|XP_008232977.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-06 >ref|XP_006491189.1| PREDICTED: pentatricopeptide repeat-containing protein At5g28460-like [Citrus sinensis] gi|641867631|gb|KDO86315.1| hypothetical protein CISIN_1g048807mg [Citrus sinensis] Length = 757 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 1 ACNPDHKSMEILTEWLSEVGQTEKLKKFVQGY 96 AC+PD+ SMEILTEWLSE GQTEKLKKFVQGY Sbjct: 719 ACHPDYISMEILTEWLSEAGQTEKLKKFVQGY 750 >ref|XP_006444949.1| hypothetical protein CICLE_v100190671mg, partial [Citrus clementina] gi|557547211|gb|ESR58189.1| hypothetical protein CICLE_v100190671mg, partial [Citrus clementina] Length = 450 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 1 ACNPDHKSMEILTEWLSEVGQTEKLKKFVQGY 96 AC+PD+ SMEILTEWLSE GQTEKLKKFVQGY Sbjct: 412 ACHPDYISMEILTEWLSEAGQTEKLKKFVQGY 443 >ref|XP_012843784.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Erythranthe guttatus] Length = 747 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 1 ACNPDHKSMEILTEWLSEVGQTEKLKKFVQGY 96 ACNPD+ +MEILTEWLSEVG+ EKL+KFVQGY Sbjct: 709 ACNPDYVTMEILTEWLSEVGEIEKLRKFVQGY 740 >ref|XP_011092997.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Sesamum indicum] Length = 742 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 1 ACNPDHKSMEILTEWLSEVGQTEKLKKFVQGY 96 ACNPD+ +MEILTEWLS VG+TEKL+KFVQGY Sbjct: 704 ACNPDYVTMEILTEWLSAVGETEKLRKFVQGY 735 >gb|EYU32173.1| hypothetical protein MIMGU_mgv1a002389mg [Erythranthe guttata] Length = 680 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 1 ACNPDHKSMEILTEWLSEVGQTEKLKKFVQGY 96 ACNPD+ +MEILTEWLSEVG+ EKL+KFVQGY Sbjct: 642 ACNPDYVTMEILTEWLSEVGEIEKLRKFVQGY 673 >ref|XP_012083305.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Jatropha curcas] Length = 756 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 1 ACNPDHKSMEILTEWLSEVGQTEKLKKFVQGY 96 ACNPD+ +MEILTEWLS VG+TEKLK FVQGY Sbjct: 718 ACNPDYITMEILTEWLSAVGETEKLKNFVQGY 749 >ref|XP_009341118.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Pyrus x bretschneideri] Length = 776 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 1 ACNPDHKSMEILTEWLSEVGQTEKLKKFVQGY 96 ACNPD+ +MEILTEWLS VG+TEKL++FVQGY Sbjct: 737 ACNPDYITMEILTEWLSAVGETEKLRRFVQGY 768 >ref|XP_008356925.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Malus domestica] Length = 774 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 1 ACNPDHKSMEILTEWLSEVGQTEKLKKFVQGY 96 ACNPD+ +MEILTEWLS VG+TEKL++FVQGY Sbjct: 736 ACNPDYITMEILTEWLSAVGETEKLRRFVQGY 767 >ref|XP_008354009.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Malus domestica] Length = 774 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 1 ACNPDHKSMEILTEWLSEVGQTEKLKKFVQGY 96 ACNPD+ +MEILTEWLS VG+TEKL++FVQGY Sbjct: 736 ACNPDYITMEILTEWLSAVGETEKLRRFVQGY 767 >ref|XP_008344990.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Malus domestica] Length = 774 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 1 ACNPDHKSMEILTEWLSEVGQTEKLKKFVQGY 96 ACNPD+ +MEILTEWLS VG+TEKL++FVQGY Sbjct: 736 ACNPDYITMEILTEWLSAVGETEKLRRFVQGY 767 >ref|XP_007220199.1| hypothetical protein PRUPE_ppa003068mg [Prunus persica] gi|462416661|gb|EMJ21398.1| hypothetical protein PRUPE_ppa003068mg [Prunus persica] Length = 607 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 1 ACNPDHKSMEILTEWLSEVGQTEKLKKFVQGY 96 ACNPD+ +MEILTEWLS VG+TEKL++FVQGY Sbjct: 569 ACNPDYITMEILTEWLSAVGETEKLRRFVQGY 600 >emb|CDP08758.1| unnamed protein product [Coffea canephora] Length = 777 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 ACNPDHKSMEILTEWLSEVGQTEKLKKFVQGY 96 ACNPD+ +MEIL EWLS VGQTEKL++FVQGY Sbjct: 739 ACNPDYVTMEILLEWLSAVGQTEKLRRFVQGY 770 >ref|XP_009350326.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Pyrus x bretschneideri] Length = 773 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +1 Query: 1 ACNPDHKSMEILTEWLSEVGQTEKLKKFVQGY 96 ACNPD+ +MEIL+EWLS VG+TEKL++FVQGY Sbjct: 735 ACNPDYVTMEILSEWLSAVGETEKLRRFVQGY 766 >ref|XP_009366564.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Pyrus x bretschneideri] gi|694380932|ref|XP_009366567.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Pyrus x bretschneideri] Length = 773 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +1 Query: 1 ACNPDHKSMEILTEWLSEVGQTEKLKKFVQGY 96 ACNPD+ +MEIL+EWLS VG+TEKL++FVQGY Sbjct: 735 ACNPDYVTMEILSEWLSAVGETEKLRRFVQGY 766 >ref|XP_007051704.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508703965|gb|EOX95861.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 764 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 ACNPDHKSMEILTEWLSEVGQTEKLKKFVQGY 96 ACNPD+ +MEILTEWLS VG++EKLK FVQGY Sbjct: 726 ACNPDYITMEILTEWLSAVGESEKLKSFVQGY 757 >ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Vitis vinifera] gi|297745328|emb|CBI40408.3| unnamed protein product [Vitis vinifera] Length = 765 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 1 ACNPDHKSMEILTEWLSEVGQTEKLKKFVQGY 96 ACNPD+ +MEILTEWLS VG+T KLK FVQGY Sbjct: 727 ACNPDYITMEILTEWLSAVGETAKLKSFVQGY 758 >ref|XP_008232977.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Prunus mume] Length = 776 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 1 ACNPDHKSMEILTEWLSEVGQTEKLKKFVQGY 96 ACNPD+ +MEILTEWLS VG+ EKL++FVQGY Sbjct: 738 ACNPDYITMEILTEWLSTVGEMEKLRRFVQGY 769