BLASTX nr result
ID: Zanthoxylum22_contig00037142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00037142 (362 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO72324.1| hypothetical protein CISIN_1g014075mg [Citrus sin... 74 4e-11 ref|XP_006430983.1| hypothetical protein CICLE_v10011780mg [Citr... 74 4e-11 ref|XP_006482453.1| PREDICTED: F-box/kelch-repeat protein At5g15... 73 1e-10 >gb|KDO72324.1| hypothetical protein CISIN_1g014075mg [Citrus sinensis] Length = 431 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 247 MESIGEASDSRSGESTVSSSQERCPKQVSPIRGGGSRN 360 ME IG+ASDSRSGE+TVSSSQERCPKQVSPIRGGGSRN Sbjct: 1 MEGIGQASDSRSGEATVSSSQERCPKQVSPIRGGGSRN 38 >ref|XP_006430983.1| hypothetical protein CICLE_v10011780mg [Citrus clementina] gi|557533040|gb|ESR44223.1| hypothetical protein CICLE_v10011780mg [Citrus clementina] Length = 431 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 247 MESIGEASDSRSGESTVSSSQERCPKQVSPIRGGGSRN 360 ME IG+ASDSRSGE+TVSSSQERCPKQVSPIRGGGSRN Sbjct: 1 MEGIGQASDSRSGEATVSSSQERCPKQVSPIRGGGSRN 38 >ref|XP_006482453.1| PREDICTED: F-box/kelch-repeat protein At5g15710-like [Citrus sinensis] Length = 431 Score = 72.8 bits (177), Expect = 1e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +1 Query: 247 MESIGEASDSRSGESTVSSSQERCPKQVSPIRGGGSRN 360 ME IG+ASDSRSGE+T+SSSQERCPKQVSPIRGGGSRN Sbjct: 1 MEGIGQASDSRSGEATLSSSQERCPKQVSPIRGGGSRN 38