BLASTX nr result
ID: Zanthoxylum22_contig00037019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00037019 (331 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012485163.1| PREDICTED: protein CLAVATA 3 [Gossypium raim... 67 4e-09 >ref|XP_012485163.1| PREDICTED: protein CLAVATA 3 [Gossypium raimondii] gi|763768226|gb|KJB35441.1| hypothetical protein B456_006G114900 [Gossypium raimondii] Length = 98 Score = 67.4 bits (163), Expect = 4e-09 Identities = 42/84 (50%), Positives = 54/84 (64%), Gaps = 5/84 (5%) Frame = +2 Query: 95 LMLLLCLGIMQEHSGAVCVTGRGCYYEELGKQNRKIL----SENEVTETGSGVNAAASGV 262 ++ LL L ++Q G CV+G GC++E+ QNRKIL EN + TG+G G Sbjct: 16 VLALLYLLVLQGVCG--CVSGHGCFHEKPA-QNRKILHADLKENNGSITGAGNMENFVGW 72 Query: 263 ELRMVPSGPDPLHHNGNT-KKPRS 331 ELR VPSGPDPLHHNG + KKPR+ Sbjct: 73 ELRAVPSGPDPLHHNGGSPKKPRT 96