BLASTX nr result
ID: Zanthoxylum22_contig00036997
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00036997 (379 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006443350.1| hypothetical protein CICLE_v10019425mg [Citr... 96 1e-17 >ref|XP_006443350.1| hypothetical protein CICLE_v10019425mg [Citrus clementina] gi|568850720|ref|XP_006479049.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Citrus sinensis] gi|557545612|gb|ESR56590.1| hypothetical protein CICLE_v10019425mg [Citrus clementina] Length = 588 Score = 95.9 bits (237), Expect = 1e-17 Identities = 49/67 (73%), Positives = 54/67 (80%) Frame = +1 Query: 178 MQGNRVIISNISRITSLARTLFSIAYIKPSQFSNSFNKTTVFNPINDFSFPFHFSSYSTS 357 MQGNRVI SN+SRITSLAR LFS AY KPS+FS S KT VF P N+F+FPFHFSS STS Sbjct: 1 MQGNRVIRSNLSRITSLARFLFSAAYTKPSEFSTSVIKTNVFTPTNNFTFPFHFSSCSTS 60 Query: 358 DLENPNA 378 +LE NA Sbjct: 61 NLETLNA 67