BLASTX nr result
ID: Zanthoxylum22_contig00036702
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00036702 (850 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO68678.1| hypothetical protein CISIN_1g038771mg [Citrus sin... 75 8e-11 ref|XP_011032666.1| PREDICTED: non-specific lipid-transfer prote... 67 3e-10 ref|XP_006479691.1| PREDICTED: non-specific lipid-transfer prote... 67 6e-10 ref|XP_002306782.2| hypothetical protein POPTR_0005s23360g [Popu... 66 9e-10 ref|XP_012435846.1| PREDICTED: non-specific lipid transfer prote... 65 1e-09 gb|KHG05270.1| hypothetical protein F383_04477 [Gossypium arboreum] 65 1e-09 ref|XP_002524755.1| lipid binding protein, putative [Ricinus com... 65 3e-09 ref|XP_008359857.1| PREDICTED: non-specific lipid-transfer prote... 65 3e-09 ref|XP_008345170.1| PREDICTED: non-specific lipid-transfer prote... 65 3e-09 gb|KJB46976.1| hypothetical protein B456_008G003500 [Gossypium r... 65 6e-09 ref|XP_004496706.1| PREDICTED: non-specific lipid-transfer prote... 64 8e-09 ref|XP_009370839.1| PREDICTED: non-specific lipid-transfer prote... 64 8e-09 ref|XP_003632315.1| PREDICTED: SH3 domain-containing protein C23... 62 1e-08 emb|CBI28717.3| unnamed protein product [Vitis vinifera] 62 1e-08 ref|XP_006444035.1| hypothetical protein CICLE_v10024613mg [Citr... 67 2e-08 ref|XP_007050547.1| Bifunctional inhibitor/lipid-transfer protei... 63 2e-08 ref|XP_004292577.1| PREDICTED: non-specific lipid-transfer prote... 64 4e-08 ref|XP_008368931.1| PREDICTED: uncharacterized protein LOC103432... 66 4e-08 ref|XP_007201645.1| hypothetical protein PRUPE_ppa021933mg [Prun... 66 4e-08 gb|KFK42886.1| hypothetical protein AALP_AA1G051500 [Arabis alpina] 65 4e-08 >gb|KDO68678.1| hypothetical protein CISIN_1g038771mg [Citrus sinensis] Length = 242 Score = 74.7 bits (182), Expect = 8e-11 Identities = 63/193 (32%), Positives = 72/193 (37%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCKCVTLCLRFSFN*FY*CLLKY*PCI 182 CL++TA+VPLQLPINRTLSLSLPRAC M G+PV+CK L Sbjct: 76 CLVITANVPLQLPINRTLSLSLPRACNMGGVPVQCKASGTPL------------------ 117 Query: 183 IFLQPLAHHYQLQVSQFIHKSLDSCLTSNGRISCFLSNIHSTNMLTRTYXXXXXXXXXXX 362 CL S G TNMLT+T Sbjct: 118 --------------------PAPGCLPSFG-----------TNMLTKTSLAGPAALFGPA 146 Query: 363 XXXRADSSLSPGGNIRLKHIPQLKLAS*LCSILINNHFFLYI*YFYIASKAVAPATGDLT 542 ADS LSP + +A A T DLT Sbjct: 147 PAPIADSPLSPRASKA------------------------------VAPAAETDTTEDLT 176 Query: 543 PASPPAESDAPTT 581 PASPP ESDAPT+ Sbjct: 177 PASPPVESDAPTS 189 >ref|XP_011032666.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Populus euphratica] Length = 207 Score = 67.4 bits (163), Expect(2) = 3e-10 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCK 110 CLL+TASVP+QLPINRTL+++LPRACKMSG+PV CK Sbjct: 74 CLLITASVPIQLPINRTLAITLPRACKMSGVPVLCK 109 Score = 25.4 bits (54), Expect(2) = 3e-10 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 194 ASGTPLPAPG 223 ASGTPLPAPG Sbjct: 110 ASGTPLPAPG 119 >ref|XP_006479691.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like [Citrus sinensis] Length = 144 Score = 66.6 bits (161), Expect(2) = 6e-10 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCK 110 CL++TA+VPLQLPINRTLSLSLPRAC M G+PV+CK Sbjct: 76 CLVITANVPLQLPINRTLSLSLPRACNMGGVPVQCK 111 Score = 25.4 bits (54), Expect(2) = 6e-10 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 194 ASGTPLPAPG 223 ASGTPLPAPG Sbjct: 112 ASGTPLPAPG 121 >ref|XP_002306782.2| hypothetical protein POPTR_0005s23360g [Populus trichocarpa] gi|550339589|gb|EEE93778.2| hypothetical protein POPTR_0005s23360g [Populus trichocarpa] Length = 207 Score = 65.9 bits (159), Expect(2) = 9e-10 Identities = 28/36 (77%), Positives = 35/36 (97%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCK 110 CLL+TA+VPLQLPINRTL+++LPRACKMSG+P+ CK Sbjct: 74 CLLITANVPLQLPINRTLAITLPRACKMSGVPMLCK 109 Score = 25.4 bits (54), Expect(2) = 9e-10 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 194 ASGTPLPAPG 223 ASGTPLPAPG Sbjct: 110 ASGTPLPAPG 119 >ref|XP_012435846.1| PREDICTED: non-specific lipid transfer protein-like 1 [Gossypium raimondii] gi|763779906|gb|KJB46977.1| hypothetical protein B456_008G003500 [Gossypium raimondii] Length = 205 Score = 65.5 bits (158), Expect(2) = 1e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCK 110 CL++TASVP QLPINRTL+LSLPRAC M G+PV+CK Sbjct: 75 CLIITASVPFQLPINRTLALSLPRACNMGGVPVQCK 110 Score = 25.4 bits (54), Expect(2) = 1e-09 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 194 ASGTPLPAPG 223 ASGTPLPAPG Sbjct: 111 ASGTPLPAPG 120 >gb|KHG05270.1| hypothetical protein F383_04477 [Gossypium arboreum] Length = 205 Score = 65.5 bits (158), Expect(2) = 1e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCK 110 CL++TASVP QLPINRTL+LSLPRAC M G+PV+CK Sbjct: 75 CLIITASVPFQLPINRTLALSLPRACNMGGVPVQCK 110 Score = 25.4 bits (54), Expect(2) = 1e-09 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 194 ASGTPLPAPG 223 ASGTPLPAPG Sbjct: 111 ASGTPLPAPG 120 >ref|XP_002524755.1| lipid binding protein, putative [Ricinus communis] gi|223535939|gb|EEF37598.1| lipid binding protein, putative [Ricinus communis] Length = 219 Score = 65.5 bits (158), Expect(2) = 3e-09 Identities = 27/36 (75%), Positives = 36/36 (100%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCK 110 CL+VTA+VP+QLPINRTL++SLPRACKM+G+P++CK Sbjct: 75 CLIVTANVPVQLPINRTLAISLPRACKMNGVPLQCK 110 Score = 23.9 bits (50), Expect(2) = 3e-09 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 194 ASGTPLPAPG 223 ASG+PLPAPG Sbjct: 111 ASGSPLPAPG 120 >ref|XP_008359857.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Malus domestica] Length = 210 Score = 65.5 bits (158), Expect(2) = 3e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCK 110 CLL+T VP+QLPINRTL+LSLPRACKM G+PV+CK Sbjct: 77 CLLITGGVPVQLPINRTLALSLPRACKMGGVPVQCK 112 Score = 23.9 bits (50), Expect(2) = 3e-09 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 194 ASGTPLPAPG 223 ASG+PLPAPG Sbjct: 113 ASGSPLPAPG 122 >ref|XP_008345170.1| PREDICTED: non-specific lipid-transfer protein-like [Malus domestica] Length = 210 Score = 65.5 bits (158), Expect(2) = 3e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCK 110 CLL+T VP+QLPINRTL+LSLPRACKM G+PV+CK Sbjct: 77 CLLITGGVPVQLPINRTLALSLPRACKMGGVPVQCK 112 Score = 23.9 bits (50), Expect(2) = 3e-09 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 194 ASGTPLPAPG 223 ASG+PLPAPG Sbjct: 113 ASGSPLPAPG 122 >gb|KJB46976.1| hypothetical protein B456_008G003500 [Gossypium raimondii] Length = 159 Score = 65.5 bits (158), Expect(2) = 6e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCK 110 CL++TASVP QLPINRTL+LSLPRAC M G+PV+CK Sbjct: 75 CLIITASVPFQLPINRTLALSLPRACNMGGVPVQCK 110 Score = 23.1 bits (48), Expect(2) = 6e-09 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 194 ASGTPLPAP 220 ASGTPLPAP Sbjct: 111 ASGTPLPAP 119 >ref|XP_004496706.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Cicer arietinum] Length = 227 Score = 64.3 bits (155), Expect(2) = 8e-09 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCK 110 CL+VTASVP ++PINRTL++SLPRACKM G+PV+CK Sbjct: 78 CLIVTASVPFKIPINRTLAISLPRACKMPGVPVQCK 113 Score = 23.9 bits (50), Expect(2) = 8e-09 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 194 ASGTPLPAPG 223 ASG+PLPAPG Sbjct: 114 ASGSPLPAPG 123 >ref|XP_009370839.1| PREDICTED: non-specific lipid-transfer protein-like [Pyrus x bretschneideri] Length = 212 Score = 64.3 bits (155), Expect(2) = 8e-09 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCK 110 CLL+T VP+QLPINRTL+LSLPRACKM G+P++CK Sbjct: 77 CLLITGGVPVQLPINRTLALSLPRACKMGGVPLQCK 112 Score = 23.9 bits (50), Expect(2) = 8e-09 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 194 ASGTPLPAPG 223 ASG+PLPAPG Sbjct: 113 ASGSPLPAPG 122 >ref|XP_003632315.1| PREDICTED: SH3 domain-containing protein C23A1.17-like [Vitis vinifera] Length = 214 Score = 62.0 bits (149), Expect(2) = 1e-08 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCK 110 CL++T SVPLQLPINRTL++SLPRAC M +P++CK Sbjct: 79 CLIITGSVPLQLPINRTLAISLPRACNMGSVPIQCK 114 Score = 25.4 bits (54), Expect(2) = 1e-08 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 194 ASGTPLPAPG 223 ASGTPLPAPG Sbjct: 115 ASGTPLPAPG 124 >emb|CBI28717.3| unnamed protein product [Vitis vinifera] Length = 178 Score = 62.0 bits (149), Expect(2) = 1e-08 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCK 110 CL++T SVPLQLPINRTL++SLPRAC M +P++CK Sbjct: 43 CLIITGSVPLQLPINRTLAISLPRACNMGSVPIQCK 78 Score = 25.4 bits (54), Expect(2) = 1e-08 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 194 ASGTPLPAPG 223 ASGTPLPAPG Sbjct: 79 ASGTPLPAPG 88 >ref|XP_006444035.1| hypothetical protein CICLE_v10024613mg [Citrus clementina] gi|557546297|gb|ESR57275.1| hypothetical protein CICLE_v10024613mg [Citrus clementina] Length = 203 Score = 66.6 bits (161), Expect = 2e-08 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCK 110 CL++TA+VPLQLPINRTLSLSLPRAC M G+PV+CK Sbjct: 76 CLVITANVPLQLPINRTLSLSLPRACNMGGVPVQCK 111 >ref|XP_007050547.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Theobroma cacao] gi|508702808|gb|EOX94704.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Theobroma cacao] Length = 214 Score = 62.8 bits (151), Expect(2) = 2e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCK 110 CL++TA+VP QLPINRTL+L LPRAC M G+PV+CK Sbjct: 74 CLIITANVPFQLPINRTLALGLPRACNMGGVPVQCK 109 Score = 23.9 bits (50), Expect(2) = 2e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 197 SGTPLPAPG 223 SGTPLPAPG Sbjct: 111 SGTPLPAPG 119 >ref|XP_004292577.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Fragaria vesca subsp. vesca] gi|764534091|ref|XP_011458583.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Fragaria vesca subsp. vesca] Length = 201 Score = 64.3 bits (155), Expect(2) = 4e-08 Identities = 27/36 (75%), Positives = 35/36 (97%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCK 110 CLLVT++VP+QLPINRTL+LSLP+ACKM G+P++CK Sbjct: 74 CLLVTSNVPVQLPINRTLALSLPKACKMGGVPLQCK 109 Score = 21.6 bits (44), Expect(2) = 4e-08 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 Query: 194 ASGTPLPAPG 223 AS +PLPAPG Sbjct: 110 ASASPLPAPG 119 >ref|XP_008368931.1| PREDICTED: uncharacterized protein LOC103432512 [Malus domestica] Length = 202 Score = 65.9 bits (159), Expect = 4e-08 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCKCVTL 122 CLL+T VP+QLPINRTL+LSLPRACKM G+PV+CK + + Sbjct: 77 CLLITGGVPVQLPINRTLALSLPRACKMGGVPVQCKDIPI 116 >ref|XP_007201645.1| hypothetical protein PRUPE_ppa021933mg [Prunus persica] gi|462397045|gb|EMJ02844.1| hypothetical protein PRUPE_ppa021933mg [Prunus persica] Length = 209 Score = 65.9 bits (159), Expect = 4e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCK 110 CLL+TASVP+QLPINRTL+LSLPRAC M G+P++CK Sbjct: 78 CLLITASVPVQLPINRTLALSLPRACNMGGIPLQCK 113 >gb|KFK42886.1| hypothetical protein AALP_AA1G051500 [Arabis alpina] Length = 167 Score = 64.7 bits (156), Expect(2) = 4e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +3 Query: 3 CLLVTASVPLQLPINRTLSLSLPRACKMSGLPVKCK 110 CL+VTASVP+ LPINRTL++SLPRAC MSG+PV+CK Sbjct: 39 CLIVTASVPINLPINRTLAISLPRACGMSGVPVQCK 74 Score = 21.2 bits (43), Expect(2) = 4e-08 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 194 ASGTPLPAPG 223 AS PLPAPG Sbjct: 75 ASAAPLPAPG 84