BLASTX nr result
ID: Zanthoxylum22_contig00036614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00036614 (354 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CEL59634.1| F-type H+-transporting ATPase subunit beta [Rhiz... 58 3e-06 ref|XP_009542892.1| beta subunit of putative F0F1-type ATP synth... 58 3e-06 emb|CCO26403.1| F-type H+-transporting ATPase subunit beta [Rhiz... 58 3e-06 emb|CDH52216.1| atp synthase f1 beta subunit [Lichtheimia corymb... 57 7e-06 >emb|CEL59634.1| F-type H+-transporting ATPase subunit beta [Rhizoctonia solani AG-1 IB] Length = 539 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/53 (52%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = -2 Query: 188 QSSPNKAQET--ATGHHNFGKIIQVVGAVVDVQFEGDNLPGLLSALEVQDFYG 36 Q +P++A T N G + V+GAVVDVQF+G+NLP +L+ALEVQDF+G Sbjct: 49 QQAPSQAARTYATPASQNIGTVKTVIGAVVDVQFDGENLPPILNALEVQDFHG 101 >ref|XP_009542892.1| beta subunit of putative F0F1-type ATP synthase [Heterobasidion irregulare TC 32-1] gi|575070507|gb|ETW86118.1| beta subunit of putative F0F1-type ATP synthase [Heterobasidion irregulare TC 32-1] Length = 544 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/57 (52%), Positives = 40/57 (70%) Frame = -2 Query: 206 SKPANTQSSPNKAQETATGHHNFGKIIQVVGAVVDVQFEGDNLPGLLSALEVQDFYG 36 ++P+ +QS+ A E T G + V+GAVVDVQFE DNLP +L+ALEVQDF+G Sbjct: 53 ARPSASQSARTYATEAKTP---IGSVKTVIGAVVDVQFESDNLPPILNALEVQDFHG 106 >emb|CCO26403.1| F-type H+-transporting ATPase subunit beta [Rhizoctonia solani AG-1 IB] Length = 523 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/53 (52%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = -2 Query: 188 QSSPNKAQET--ATGHHNFGKIIQVVGAVVDVQFEGDNLPGLLSALEVQDFYG 36 Q +P++A T N G + V+GAVVDVQF+G+NLP +L+ALEVQDF+G Sbjct: 49 QQAPSQAARTYATPASQNIGTVKTVIGAVVDVQFDGENLPPILNALEVQDFHG 101 >emb|CDH52216.1| atp synthase f1 beta subunit [Lichtheimia corymbifera JMRC:FSU:9682] Length = 499 Score = 56.6 bits (135), Expect = 7e-06 Identities = 30/57 (52%), Positives = 41/57 (71%) Frame = -2 Query: 206 SKPANTQSSPNKAQETATGHHNFGKIIQVVGAVVDVQFEGDNLPGLLSALEVQDFYG 36 +KP Q++ NKA+ AT + G+I V+GAVVDVQF+ +NLP +L+ALEVQD G Sbjct: 24 TKPLGVQAA-NKARAYATEAQSAGQIRSVIGAVVDVQFDQENLPAILNALEVQDHTG 79