BLASTX nr result
ID: Zanthoxylum22_contig00036350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00036350 (292 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007793281.1| hypothetical protein UCREL1_5371 [Eutypa lat... 57 5e-06 >ref|XP_007793281.1| hypothetical protein UCREL1_5371 [Eutypa lata UCREL1] gi|471567720|gb|EMR67610.1| hypothetical protein UCREL1_5371 [Eutypa lata UCREL1] Length = 142 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 9/80 (11%) Frame = -3 Query: 230 TPVRILLFGKIPEHIKTVSETVQPEAQVIQVASTNEDAIAALQSYLS---------GPKN 78 TP+ ILL GK+P HI+ + ++PE VI+V S E A AA+ + +S G + Sbjct: 2 TPIPILLCGKLPSHIQATRDIIKPEFDVIKVCSDPEAARAAVTALMSPSAENHTLEGVEY 61 Query: 77 EMPHMVVMGGGFTPADYEQV 18 PH++VMG G++ D+ + Sbjct: 62 PKPHLIVMGAGYSHDDFSSI 81