BLASTX nr result
ID: Zanthoxylum22_contig00036014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00036014 (368 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006291806.1| orf36 (mitochondrion) [Daucus carota subsp. ... 74 6e-11 >ref|YP_006291806.1| orf36 (mitochondrion) [Daucus carota subsp. sativus] gi|374081982|gb|AEY81174.1| orf36 (mitochondrion) [Daucus carota subsp. sativus] Length = 155 Score = 73.6 bits (179), Expect = 6e-11 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = +1 Query: 229 DGFCRSNENRFLLFLPFWLDYSACLTQV*FNLHGLLHHPASSGSKA 366 D NE+ FLLFLP WLDYSACLTQV FNLHG LH+PAS GSKA Sbjct: 108 DALIEENEDSFLLFLPIWLDYSACLTQVLFNLHGPLHYPASVGSKA 153