BLASTX nr result
ID: Zanthoxylum22_contig00035992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00035992 (653 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006444185.1| hypothetical protein CICLE_v10019759mg [Citr... 63 1e-07 >ref|XP_006444185.1| hypothetical protein CICLE_v10019759mg [Citrus clementina] gi|567903396|ref|XP_006444186.1| hypothetical protein CICLE_v10019759mg [Citrus clementina] gi|568852322|ref|XP_006479827.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like isoform X1 [Citrus sinensis] gi|557546447|gb|ESR57425.1| hypothetical protein CICLE_v10019759mg [Citrus clementina] gi|557546448|gb|ESR57426.1| hypothetical protein CICLE_v10019759mg [Citrus clementina] gi|641868767|gb|KDO87451.1| hypothetical protein CISIN_1g010292mg [Citrus sinensis] gi|641868768|gb|KDO87452.1| hypothetical protein CISIN_1g010292mg [Citrus sinensis] gi|641868769|gb|KDO87453.1| hypothetical protein CISIN_1g010292mg [Citrus sinensis] Length = 513 Score = 63.2 bits (152), Expect = 1e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 651 WIMYKAYSTYGQRLKVNQILGLMCKYGYDIPVDAF 547 WIMY AY+T GQR KVNQ+LGLMCK GYD+PV+AF Sbjct: 477 WIMYYAYATCGQRRKVNQVLGLMCKNGYDVPVNAF 511