BLASTX nr result
ID: Zanthoxylum22_contig00035887
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00035887 (437 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006468264.1| PREDICTED: pentatricopeptide repeat-containi... 55 2e-20 ref|XP_006448964.1| hypothetical protein CICLE_v10014263mg [Citr... 55 3e-20 gb|KDO75350.1| hypothetical protein CISIN_1g037695mg [Citrus sin... 55 5e-16 ref|XP_012092557.1| PREDICTED: pentatricopeptide repeat-containi... 50 4e-12 ref|XP_008225527.1| PREDICTED: pentatricopeptide repeat-containi... 49 7e-12 ref|XP_007214696.1| hypothetical protein PRUPE_ppa026763mg, part... 49 7e-12 ref|XP_008371634.1| PREDICTED: pentatricopeptide repeat-containi... 48 3e-11 ref|XP_012453778.1| PREDICTED: pentatricopeptide repeat-containi... 46 5e-11 ref|XP_009360940.1| PREDICTED: pentatricopeptide repeat-containi... 47 1e-10 ref|XP_002272135.2| PREDICTED: pentatricopeptide repeat-containi... 47 2e-10 emb|CBI30945.3| unnamed protein product [Vitis vinifera] 47 2e-10 emb|CAN80625.1| hypothetical protein VITISV_032617 [Vitis vinifera] 47 2e-10 ref|XP_008371794.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 49 3e-10 ref|XP_010275050.1| PREDICTED: pentatricopeptide repeat-containi... 49 5e-10 ref|XP_010056941.1| PREDICTED: pentatricopeptide repeat-containi... 46 6e-10 ref|XP_004485976.1| PREDICTED: pentatricopeptide repeat-containi... 45 6e-10 gb|KCW73858.1| hypothetical protein EUGRSUZ_E02454 [Eucalyptus g... 46 6e-10 ref|XP_003541675.1| PREDICTED: pentatricopeptide repeat-containi... 46 2e-09 ref|XP_002316718.1| pentatricopeptide repeat-containing family p... 46 2e-09 ref|XP_014519176.1| PREDICTED: pentatricopeptide repeat-containi... 44 2e-09 >ref|XP_006468264.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Citrus sinensis] Length = 837 Score = 55.1 bits (131), Expect(3) = 2e-20 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 235 EEIRGVELKKDEFRHPLVREVCRSIELRSGFEPK 336 EEIR V L++DEFRHPLVREVCR IELRS + PK Sbjct: 156 EEIRRVVLEEDEFRHPLVREVCRLIELRSAWSPK 189 Score = 47.8 bits (112), Expect(3) = 2e-20 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +2 Query: 329 NPKIEGELRNLLINLKPRLVCAVLRSLADE 418 +PK+EGELRNLL +LKPR +CAVL S ADE Sbjct: 187 SPKLEGELRNLLRSLKPRQICAVLHSQADE 216 Score = 42.7 bits (99), Expect(3) = 2e-20 Identities = 21/38 (55%), Positives = 25/38 (65%) Frame = +3 Query: 3 SNDGYDKFKQMGIQNSVDLSLFGIVIVRLEKEKIGNFD 116 SNDGY KF QMG Q+S DLSLFG +K + +FD Sbjct: 86 SNDGYHKFNQMGTQDSSDLSLFGSDNAEFDKSEKCDFD 123 >ref|XP_006448964.1| hypothetical protein CICLE_v10014263mg [Citrus clementina] gi|557551575|gb|ESR62204.1| hypothetical protein CICLE_v10014263mg [Citrus clementina] Length = 837 Score = 55.1 bits (131), Expect(3) = 3e-20 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 235 EEIRGVELKKDEFRHPLVREVCRSIELRSGFEPK 336 EEIR V L++DEFRHPLVREVCR IELRS + PK Sbjct: 156 EEIRRVVLEEDEFRHPLVREVCRLIELRSAWSPK 189 Score = 49.7 bits (117), Expect(3) = 3e-20 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 329 NPKIEGELRNLLINLKPRLVCAVLRSLADE 418 +PK+EGELRNLL +LKPR +CAVLRS ADE Sbjct: 187 SPKLEGELRNLLRSLKPRQICAVLRSQADE 216 Score = 40.4 bits (93), Expect(3) = 3e-20 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = +3 Query: 3 SNDGYDKFKQMGIQNSVDLSLFGIVIVRLEKEKIGNFD 116 +NDGY KF QMG Q+S DLSLFG +K + +FD Sbjct: 86 NNDGYHKFNQMGTQDSSDLSLFGSDNGEFDKSEKCDFD 123 >gb|KDO75350.1| hypothetical protein CISIN_1g037695mg [Citrus sinensis] Length = 701 Score = 55.1 bits (131), Expect(3) = 5e-16 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 235 EEIRGVELKKDEFRHPLVREVCRSIELRSGFEPK 336 EEIR V L++DEFRHPLVREVCR IELRS + PK Sbjct: 61 EEIRRVVLEEDEFRHPLVREVCRLIELRSAWSPK 94 Score = 49.7 bits (117), Expect(3) = 5e-16 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 329 NPKIEGELRNLLINLKPRLVCAVLRSLADE 418 +PK+EGELRNLL +LKPR +CAVLRS ADE Sbjct: 92 SPKLEGELRNLLRSLKPRQICAVLRSQADE 121 Score = 25.8 bits (55), Expect(3) = 5e-16 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 33 MGIQNSVDLSLFGIVIVRLEKEKIGNFD 116 MG Q+S DLSLFG +K + +FD Sbjct: 1 MGTQDSSDLSLFGSDNAEFDKSEKCDFD 28 >ref|XP_012092557.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic [Jatropha curcas] gi|802795643|ref|XP_012092558.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic [Jatropha curcas] gi|802795647|ref|XP_012092559.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic [Jatropha curcas] gi|643702015|gb|KDP20455.1| hypothetical protein JCGZ_05300 [Jatropha curcas] Length = 833 Score = 50.1 bits (118), Expect(2) = 4e-12 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = +2 Query: 314 LDQVLNPKIEGELRNLLINLKPRLVCAVLRSLADE 418 L Q NPK+EGE+R LL NLKPR VCAVL S ADE Sbjct: 178 LRQAWNPKLEGEMRRLLRNLKPRQVCAVLLSQADE 212 Score = 47.4 bits (111), Expect(2) = 4e-12 Identities = 19/34 (55%), Positives = 27/34 (79%) Frame = +1 Query: 235 EEIRGVELKKDEFRHPLVREVCRSIELRSGFEPK 336 E++ +E+ ++EFRHPLVRE+CR IELR + PK Sbjct: 152 EDVWRIEIGEEEFRHPLVREICRLIELRQAWNPK 185 >ref|XP_008225527.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Prunus mume] Length = 823 Score = 48.9 bits (115), Expect(2) = 7e-12 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = +1 Query: 250 VELKKDEFRHPLVREVCRSIELRSGFEPK 336 VE +DEFRHPLVREVCR +ELRSG+ PK Sbjct: 147 VEGDEDEFRHPLVREVCRLLELRSGWNPK 175 Score = 47.8 bits (112), Expect(2) = 7e-12 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +2 Query: 329 NPKIEGELRNLLINLKPRLVCAVLRSLADE 418 NPK+EG+LRNLL +LK R VCAVLRS ADE Sbjct: 173 NPKLEGQLRNLLRSLKARQVCAVLRSQADE 202 >ref|XP_007214696.1| hypothetical protein PRUPE_ppa026763mg, partial [Prunus persica] gi|462410561|gb|EMJ15895.1| hypothetical protein PRUPE_ppa026763mg, partial [Prunus persica] Length = 802 Score = 48.9 bits (115), Expect(2) = 7e-12 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = +1 Query: 250 VELKKDEFRHPLVREVCRSIELRSGFEPK 336 VE +DEFRHPLVREVCR +ELRSG+ PK Sbjct: 126 VEGDEDEFRHPLVREVCRLLELRSGWNPK 154 Score = 47.8 bits (112), Expect(2) = 7e-12 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +2 Query: 329 NPKIEGELRNLLINLKPRLVCAVLRSLADE 418 NPK+EG+LRNLL +LK R VCAVLRS ADE Sbjct: 152 NPKLEGQLRNLLRSLKARQVCAVLRSQADE 181 >ref|XP_008371634.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Malus domestica] Length = 843 Score = 48.1 bits (113), Expect(2) = 3e-11 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = +1 Query: 235 EEIRGVELKKDEFRHPLVREVCRSIELRSGFEPK 336 E R V+ ++EFRHPLVREVCR IE RSG+ PK Sbjct: 162 ENFRRVDGYEEEFRHPLVREVCRLIEFRSGWSPK 195 Score = 46.6 bits (109), Expect(2) = 3e-11 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +2 Query: 329 NPKIEGELRNLLINLKPRLVCAVLRSLADE 418 +PK+EGEL+NLL +LKPR VCAVL+S +DE Sbjct: 193 SPKLEGELKNLLRSLKPRQVCAVLKSQSDE 222 >ref|XP_012453778.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242162|ref|XP_012453779.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242164|ref|XP_012453780.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242166|ref|XP_012453781.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242168|ref|XP_012453782.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242170|ref|XP_012453783.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242172|ref|XP_012453784.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] Length = 807 Score = 45.8 bits (107), Expect(3) = 5e-11 Identities = 19/35 (54%), Positives = 27/35 (77%) Frame = +1 Query: 232 TEEIRGVELKKDEFRHPLVREVCRSIELRSGFEPK 336 TE++ +EL++DE RHPLVRE+CR I+ RS + K Sbjct: 130 TEDVWRIELEEDELRHPLVREICRLIQCRSAWNAK 164 Score = 37.0 bits (84), Expect(3) = 5e-11 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = +2 Query: 329 NPKIEGELRNLLINLKPRLVCAVLRSLADE 418 N K+E ++R+LL +LKPR VCAVL S DE Sbjct: 162 NAKLERDMRHLLRSLKPRQVCAVLLSQDDE 191 Score = 30.4 bits (67), Expect(3) = 5e-11 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 6 NDGYDKFKQMGIQNSVDLSLFGIVIVRLEKEKIGNFD 116 N + KF++MG+++S +LSLFG ++ + NFD Sbjct: 62 NADFGKFREMGVEDSRELSLFGDNNGGYQRNRSLNFD 98 >ref|XP_009360940.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62680, mitochondrial [Pyrus x bretschneideri] Length = 846 Score = 46.6 bits (109), Expect(2) = 1e-10 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +2 Query: 329 NPKIEGELRNLLINLKPRLVCAVLRSLADE 418 +PK+EGEL+NLL +LKPR VCAVL+S +DE Sbjct: 196 SPKLEGELKNLLRSLKPRQVCAVLKSQSDE 225 Score = 45.8 bits (107), Expect(2) = 1e-10 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = +1 Query: 235 EEIRGVELKKDEFRHPLVREVCRSIELRSGFEPK 336 E V+ ++EFRHPLVREVCR IE RSG+ PK Sbjct: 165 ENFGRVDGDEEEFRHPLVREVCRLIEFRSGWSPK 198 >ref|XP_002272135.2| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Vitis vinifera] Length = 827 Score = 47.4 bits (111), Expect(2) = 2e-10 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = +1 Query: 232 TEEIRGVELKKDEFRHPLVREVCRSIELRSGFEPK 336 TE IR E +DE RHPLVRE+CR IELRS + PK Sbjct: 147 TEGIRRFEGGEDESRHPLVREICRLIELRSAWNPK 181 Score = 44.7 bits (104), Expect(2) = 2e-10 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +2 Query: 329 NPKIEGELRNLLINLKPRLVCAVLRSLADE 418 NPK+EGELR+LL +LKPR VCAVL+ DE Sbjct: 179 NPKLEGELRHLLRSLKPRQVCAVLQLQTDE 208 >emb|CBI30945.3| unnamed protein product [Vitis vinifera] Length = 796 Score = 47.4 bits (111), Expect(2) = 2e-10 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = +1 Query: 232 TEEIRGVELKKDEFRHPLVREVCRSIELRSGFEPK 336 TE IR E +DE RHPLVRE+CR IELRS + PK Sbjct: 147 TEGIRRFEGGEDESRHPLVREICRLIELRSAWNPK 181 Score = 44.7 bits (104), Expect(2) = 2e-10 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +2 Query: 329 NPKIEGELRNLLINLKPRLVCAVLRSLADE 418 NPK+EGELR+LL +LKPR VCAVL+ DE Sbjct: 179 NPKLEGELRHLLRSLKPRQVCAVLQLQTDE 208 >emb|CAN80625.1| hypothetical protein VITISV_032617 [Vitis vinifera] Length = 733 Score = 47.4 bits (111), Expect(2) = 2e-10 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = +1 Query: 232 TEEIRGVELKKDEFRHPLVREVCRSIELRSGFEPK 336 TE IR E +DE RHPLVRE+CR IELRS + PK Sbjct: 53 TEGIRRFEGGEDESRHPLVREICRLIELRSAWNPK 87 Score = 44.7 bits (104), Expect(2) = 2e-10 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +2 Query: 329 NPKIEGELRNLLINLKPRLVCAVLRSLADE 418 NPK+EGELR+LL +LKPR VCAVL+ DE Sbjct: 85 NPKLEGELRHLLRSLKPRQVCAVLQLQTDE 114 >ref|XP_008371794.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Malus domestica] Length = 717 Score = 48.5 bits (114), Expect(2) = 3e-10 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = +1 Query: 235 EEIRGVELKKDEFRHPLVREVCRSIELRSGFEPK 336 E R VE + EFRHPLVREVCR IE RSG+ PK Sbjct: 42 ENFRRVEGDEKEFRHPLVREVCRLIEFRSGWNPK 75 Score = 42.7 bits (99), Expect(2) = 3e-10 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = +2 Query: 329 NPKIEGELRNLLINLKPRLVCAVLRSLADE 418 NPK+EGEL+NLL LK R VC VL+S +DE Sbjct: 73 NPKLEGELKNLLKXLKRRQVCTVLKSQSDE 102 >ref|XP_010275050.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Nelumbo nucifera] gi|720061056|ref|XP_010275051.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Nelumbo nucifera] gi|720061060|ref|XP_010275052.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Nelumbo nucifera] gi|720061063|ref|XP_010275053.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Nelumbo nucifera] Length = 824 Score = 48.5 bits (114), Expect(2) = 5e-10 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 329 NPKIEGELRNLLINLKPRLVCAVLRSLADE 418 NPK+EG+LR+LL +LKPR VCAVLRS ADE Sbjct: 179 NPKLEGDLRHLLRSLKPRHVCAVLRSQADE 208 Score = 42.0 bits (97), Expect(2) = 5e-10 Identities = 17/28 (60%), Positives = 23/28 (82%) Frame = +1 Query: 253 ELKKDEFRHPLVREVCRSIELRSGFEPK 336 E+++D FRHPLVRE+CR I+ RS + PK Sbjct: 154 EVEEDVFRHPLVREICRLIDRRSAWNPK 181 >ref|XP_010056941.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Eucalyptus grandis] gi|702344977|ref|XP_010056942.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Eucalyptus grandis] Length = 801 Score = 45.8 bits (107), Expect(2) = 6e-10 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = +2 Query: 314 LDQVLNPKIEGELRNLLINLKPRLVCAVLRSLADE 418 L V NP EGELR+LL +LKPR VCAVLR+ DE Sbjct: 152 LRSVWNPNFEGELRHLLRSLKPRQVCAVLRAQEDE 186 Score = 44.3 bits (103), Expect(2) = 6e-10 Identities = 22/41 (53%), Positives = 28/41 (68%) Frame = +1 Query: 211 LSTKNM*TEEIRGVELKKDEFRHPLVREVCRSIELRSGFEP 333 L KN ++ +R VE DE RHPLVREVCR ++LRS + P Sbjct: 118 LGLKNGRSDCVRSVEECGDELRHPLVREVCRLVQLRSVWNP 158 >ref|XP_004485976.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62914, mitochondrial [Cicer arietinum] Length = 784 Score = 45.4 bits (106), Expect(2) = 6e-10 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = +2 Query: 329 NPKIEGELRNLLINLKPRLVCAVLRSLADE 418 NPK EG LR+LL +LKP LVCAVLRS DE Sbjct: 138 NPKFEGNLRHLLRSLKPPLVCAVLRSQVDE 167 Score = 44.7 bits (104), Expect(2) = 6e-10 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +1 Query: 235 EEIRGVELKKDEFRHPLVREVCRSIELRSGFEPK 336 E I E+ + EFRHPLVREVCR I LRS + PK Sbjct: 107 ENIARFEIDESEFRHPLVREVCRLITLRSTWNPK 140 >gb|KCW73858.1| hypothetical protein EUGRSUZ_E02454 [Eucalyptus grandis] Length = 737 Score = 45.8 bits (107), Expect(2) = 6e-10 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = +2 Query: 314 LDQVLNPKIEGELRNLLINLKPRLVCAVLRSLADE 418 L V NP EGELR+LL +LKPR VCAVLR+ DE Sbjct: 88 LRSVWNPNFEGELRHLLRSLKPRQVCAVLRAQEDE 122 Score = 44.3 bits (103), Expect(2) = 6e-10 Identities = 22/41 (53%), Positives = 28/41 (68%) Frame = +1 Query: 211 LSTKNM*TEEIRGVELKKDEFRHPLVREVCRSIELRSGFEP 333 L KN ++ +R VE DE RHPLVREVCR ++LRS + P Sbjct: 54 LGLKNGRSDCVRSVEECGDELRHPLVREVCRLVQLRSVWNP 94 >ref|XP_003541675.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Glycine max] gi|947072225|gb|KRH21116.1| hypothetical protein GLYMA_13G221600 [Glycine max] Length = 789 Score = 46.2 bits (108), Expect(2) = 2e-09 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +2 Query: 314 LDQVLNPKIEGELRNLLINLKPRLVCAVLRSLADE 418 L NP EG LR+LL +LKP LVCAVLRS ADE Sbjct: 142 LSSAWNPNFEGRLRHLLRSLKPSLVCAVLRSQADE 176 Score = 42.4 bits (98), Expect(2) = 2e-09 Identities = 18/34 (52%), Positives = 23/34 (67%) Frame = +1 Query: 232 TEEIRGVELKKDEFRHPLVREVCRSIELRSGFEP 333 T+ I +E+ EFRHP+VREVCR I L S + P Sbjct: 115 TQNIASIEIDDSEFRHPVVREVCRLITLSSAWNP 148 >ref|XP_002316718.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222859783|gb|EEE97330.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 684 Score = 46.2 bits (108), Expect(2) = 2e-09 Identities = 20/34 (58%), Positives = 26/34 (76%) Frame = +1 Query: 235 EEIRGVELKKDEFRHPLVREVCRSIELRSGFEPK 336 E+ R +E+ +DEFRHPLVRE+CR IE RS + K Sbjct: 3 EDWRRIEIHEDEFRHPLVREICRLIECRSAWNHK 36 Score = 42.4 bits (98), Expect(2) = 2e-09 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = +2 Query: 329 NPKIEGELRNLLINLKPRLVCAVLRSLADE 418 N K+EG++R+LL LKPRLVCAVL S +DE Sbjct: 34 NHKLEGKMRHLLRGLKPRLVCAVLLSQSDE 63 >ref|XP_014519176.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62720 [Vigna radiata var. radiata] gi|951046430|ref|XP_014519177.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62720 [Vigna radiata var. radiata] gi|951046433|ref|XP_014519178.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62720 [Vigna radiata var. radiata] gi|951046437|ref|XP_014519179.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62720 [Vigna radiata var. radiata] Length = 792 Score = 44.3 bits (103), Expect(2) = 2e-09 Identities = 21/39 (53%), Positives = 26/39 (66%) Frame = +1 Query: 217 TKNM*TEEIRGVELKKDEFRHPLVREVCRSIELRSGFEP 333 +K E I +E+ + EFRHPLVREVCR I LRS + P Sbjct: 113 SKQQQRESIARIEIGEAEFRHPLVREVCRLITLRSAWNP 151 Score = 43.9 bits (102), Expect(2) = 2e-09 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +2 Query: 329 NPKIEGELRNLLINLKPRLVCAVLRSLADE 418 NP +EG LR+LL +LKP LVCAVLRS DE Sbjct: 150 NPDLEGHLRHLLRSLKPPLVCAVLRSQTDE 179