BLASTX nr result
ID: Zanthoxylum22_contig00035795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00035795 (493 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006484804.1| PREDICTED: pentatricopeptide repeat-containi... 131 2e-28 ref|XP_006437247.1| hypothetical protein CICLE_v10031787mg [Citr... 131 2e-28 ref|XP_011089644.1| PREDICTED: pentatricopeptide repeat-containi... 109 7e-22 ref|XP_004293124.2| PREDICTED: pentatricopeptide repeat-containi... 108 2e-21 ref|XP_008244680.1| PREDICTED: pentatricopeptide repeat-containi... 108 2e-21 ref|XP_012085223.1| PREDICTED: pentatricopeptide repeat-containi... 108 2e-21 ref|XP_007199919.1| hypothetical protein PRUPE_ppa006910mg [Prun... 108 2e-21 ref|XP_008368045.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 106 6e-21 ref|XP_008382583.1| PREDICTED: pentatricopeptide repeat-containi... 106 6e-21 ref|XP_008382582.1| PREDICTED: pentatricopeptide repeat-containi... 106 6e-21 ref|XP_002301807.2| hypothetical protein POPTR_0002s24950g [Popu... 106 6e-21 ref|XP_009773350.1| PREDICTED: pentatricopeptide repeat-containi... 106 8e-21 ref|XP_009599094.1| PREDICTED: pentatricopeptide repeat-containi... 106 8e-21 ref|XP_009349112.1| PREDICTED: pentatricopeptide repeat-containi... 105 1e-20 emb|CBI19389.3| unnamed protein product [Vitis vinifera] 104 2e-20 ref|XP_002283378.1| PREDICTED: pentatricopeptide repeat-containi... 104 2e-20 ref|XP_011024593.1| PREDICTED: pentatricopeptide repeat-containi... 103 4e-20 ref|XP_010069616.1| PREDICTED: pentatricopeptide repeat-containi... 103 4e-20 ref|XP_008356253.1| PREDICTED: pentatricopeptide repeat-containi... 102 9e-20 ref|XP_012833555.1| PREDICTED: pentatricopeptide repeat-containi... 102 9e-20 >ref|XP_006484804.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Citrus sinensis] Length = 388 Score = 131 bits (330), Expect = 2e-28 Identities = 61/71 (85%), Positives = 68/71 (95%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 FEDA+ ++FDMLGNSMGPDMLTYKTLLEGLCR+GR SEAF+LLEEFRK+DVV+GDRNYKT Sbjct: 318 FEDALEVLFDMLGNSMGPDMLTYKTLLEGLCREGRESEAFDLLEEFRKRDVVMGDRNYKT 377 Query: 308 LLNGLHFLNQE 276 LLNGLHF NQE Sbjct: 378 LLNGLHFQNQE 388 >ref|XP_006437247.1| hypothetical protein CICLE_v10031787mg [Citrus clementina] gi|557539443|gb|ESR50487.1| hypothetical protein CICLE_v10031787mg [Citrus clementina] Length = 388 Score = 131 bits (330), Expect = 2e-28 Identities = 61/71 (85%), Positives = 68/71 (95%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 FEDA+ ++FDMLGNSMGPDMLTYKTLLEGLCR+GR SEAF+LLEEFRK+DVV+GDRNYKT Sbjct: 318 FEDALEVLFDMLGNSMGPDMLTYKTLLEGLCREGRESEAFDLLEEFRKRDVVMGDRNYKT 377 Query: 308 LLNGLHFLNQE 276 LLNGLHF NQE Sbjct: 378 LLNGLHFQNQE 388 >ref|XP_011089644.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Sesamum indicum] Length = 375 Score = 109 bits (273), Expect = 7e-22 Identities = 48/71 (67%), Positives = 62/71 (87%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 F+DAI++ FDMLG+SM PD+LTYKTLLE +CRDGRG +AFELLEEFRK+D + ++ Y T Sbjct: 304 FQDAIDIAFDMLGSSMSPDLLTYKTLLEEMCRDGRGDDAFELLEEFRKRDSFMNEKTYNT 363 Query: 308 LLNGLHFLNQE 276 LLNGLHFL+++ Sbjct: 364 LLNGLHFLSRD 374 >ref|XP_004293124.2| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Fragaria vesca subsp. vesca] Length = 373 Score = 108 bits (270), Expect = 2e-21 Identities = 48/71 (67%), Positives = 60/71 (84%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 +EDA ++VFDML NS+ PD+LTYKTLLEGLCRDG+G EAF+LLE FR +D + +R YKT Sbjct: 303 YEDASDVVFDMLSNSVSPDLLTYKTLLEGLCRDGKGEEAFDLLENFRSRDRAMNERTYKT 362 Query: 308 LLNGLHFLNQE 276 LLN LHF+N+E Sbjct: 363 LLNALHFINKE 373 >ref|XP_008244680.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Prunus mume] Length = 397 Score = 108 bits (269), Expect = 2e-21 Identities = 49/71 (69%), Positives = 60/71 (84%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 ++DA +V DML NSM PD+LTYKTLLEGLCRDG+GSEAF+LLE+FRK D +G++ YKT Sbjct: 327 YDDASEVVLDMLSNSMSPDLLTYKTLLEGLCRDGKGSEAFDLLEDFRKGDSKMGEKTYKT 386 Query: 308 LLNGLHFLNQE 276 LLN LHF+N E Sbjct: 387 LLNALHFVNGE 397 >ref|XP_012085223.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Jatropha curcas] gi|643739523|gb|KDP45277.1| hypothetical protein JCGZ_15142 [Jatropha curcas] Length = 385 Score = 108 bits (269), Expect = 2e-21 Identities = 48/71 (67%), Positives = 59/71 (83%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 FEDAI +VFDMLGNSM PD+LTYKT+LEGLCR+G+ EAFEL+EEFRK+D ++ + Y Sbjct: 315 FEDAIEVVFDMLGNSMSPDLLTYKTVLEGLCREGKSDEAFELIEEFRKRDGLMSQKTYNI 374 Query: 308 LLNGLHFLNQE 276 LLN LH +NQE Sbjct: 375 LLNALHIINQE 385 >ref|XP_007199919.1| hypothetical protein PRUPE_ppa006910mg [Prunus persica] gi|462395319|gb|EMJ01118.1| hypothetical protein PRUPE_ppa006910mg [Prunus persica] Length = 390 Score = 108 bits (269), Expect = 2e-21 Identities = 49/71 (69%), Positives = 60/71 (84%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 ++DA +V DML NSM PD+LTYKTLLEGLCRDG+GSEAF+LLE+FRK D +G++ YKT Sbjct: 320 YDDASEVVLDMLSNSMSPDLLTYKTLLEGLCRDGKGSEAFDLLEDFRKGDSKMGEKTYKT 379 Query: 308 LLNGLHFLNQE 276 LLN LHF+N E Sbjct: 380 LLNALHFVNGE 390 >ref|XP_008368045.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Malus domestica] Length = 359 Score = 106 bits (265), Expect = 6e-21 Identities = 47/71 (66%), Positives = 60/71 (84%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 ++DA +V DML N+M PD+LTYKTLLEGLCRDG+G EAF+LLE+FR+KD ++ +R YKT Sbjct: 289 YDDATEVVLDMLSNAMSPDLLTYKTLLEGLCRDGKGVEAFDLLEDFRRKDSMMNERTYKT 348 Query: 308 LLNGLHFLNQE 276 LLN LHF+N E Sbjct: 349 LLNALHFVNGE 359 >ref|XP_008382583.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial isoform X2 [Malus domestica] Length = 291 Score = 106 bits (265), Expect = 6e-21 Identities = 47/71 (66%), Positives = 60/71 (84%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 ++DA +V DML N+M PD+LTYKTLLEGLCRDG+G EAF+LLE+FR+KD ++ +R YKT Sbjct: 221 YDDATEVVLDMLSNAMSPDLLTYKTLLEGLCRDGKGVEAFDLLEDFRRKDSMMNERTYKT 280 Query: 308 LLNGLHFLNQE 276 LLN LHF+N E Sbjct: 281 LLNALHFVNGE 291 >ref|XP_008382582.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial isoform X1 [Malus domestica] Length = 396 Score = 106 bits (265), Expect = 6e-21 Identities = 47/71 (66%), Positives = 60/71 (84%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 ++DA +V DML N+M PD+LTYKTLLEGLCRDG+G EAF+LLE+FR+KD ++ +R YKT Sbjct: 326 YDDATEVVLDMLSNAMSPDLLTYKTLLEGLCRDGKGVEAFDLLEDFRRKDSMMNERTYKT 385 Query: 308 LLNGLHFLNQE 276 LLN LHF+N E Sbjct: 386 LLNALHFVNGE 396 >ref|XP_002301807.2| hypothetical protein POPTR_0002s24950g [Populus trichocarpa] gi|550345772|gb|EEE81080.2| hypothetical protein POPTR_0002s24950g [Populus trichocarpa] Length = 387 Score = 106 bits (265), Expect = 6e-21 Identities = 47/71 (66%), Positives = 64/71 (90%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 FE+AI +VFDMLG+SM PD+LTY+T+LEGLCR+G +AFELLEE+RKKD +G++NYK+ Sbjct: 317 FEEAIGVVFDMLGDSMSPDLLTYRTVLEGLCREGMVDKAFELLEEWRKKDGFMGEKNYKS 376 Query: 308 LLNGLHFLNQE 276 LLNGLHF++++ Sbjct: 377 LLNGLHFVSRQ 387 >ref|XP_009773350.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Nicotiana sylvestris] Length = 380 Score = 106 bits (264), Expect = 8e-21 Identities = 47/71 (66%), Positives = 62/71 (87%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 FEDAI +VFDML NS+ PD LTYKT+LE LCR+GRGS AFE+L+EF+K+D ++ ++ YK+ Sbjct: 310 FEDAIEVVFDMLDNSLSPDQLTYKTVLEELCREGRGSYAFEILDEFKKRDSLMNEKTYKS 369 Query: 308 LLNGLHFLNQE 276 LLNGL+FLNQ+ Sbjct: 370 LLNGLYFLNQD 380 >ref|XP_009599094.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Nicotiana tomentosiformis] Length = 381 Score = 106 bits (264), Expect = 8e-21 Identities = 47/71 (66%), Positives = 62/71 (87%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 FEDAI +VFDML NS+ PD LTYKT+LE LCR+GRG+ AFE+LEEF+K+D ++ ++ YK+ Sbjct: 311 FEDAIEVVFDMLDNSLSPDQLTYKTVLEELCREGRGNYAFEILEEFKKRDSLMNEKTYKS 370 Query: 308 LLNGLHFLNQE 276 LLNGL+FLNQ+ Sbjct: 371 LLNGLYFLNQD 381 >ref|XP_009349112.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Pyrus x bretschneideri] Length = 397 Score = 105 bits (262), Expect = 1e-20 Identities = 47/71 (66%), Positives = 60/71 (84%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 ++DAI +V DML N+M PD+LTYKTLLEGLCRDG+G EAF+LLE+ R+KD ++ +R YKT Sbjct: 327 YDDAIEVVLDMLRNAMSPDLLTYKTLLEGLCRDGKGVEAFDLLEDLRRKDSMMNERTYKT 386 Query: 308 LLNGLHFLNQE 276 LLN LHF+N E Sbjct: 387 LLNALHFVNGE 397 >emb|CBI19389.3| unnamed protein product [Vitis vinifera] Length = 365 Score = 104 bits (260), Expect = 2e-20 Identities = 47/71 (66%), Positives = 61/71 (85%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 FE+A ++FDMLGNSM PD+LTYKTLLEGL R+G+ ++AFELLE+ RKKD +G++ YKT Sbjct: 295 FEEATKILFDMLGNSMAPDLLTYKTLLEGLSREGKCNDAFELLEDLRKKDAWMGEKTYKT 354 Query: 308 LLNGLHFLNQE 276 L+ GLHFL+QE Sbjct: 355 LVKGLHFLSQE 365 >ref|XP_002283378.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Vitis vinifera] Length = 393 Score = 104 bits (260), Expect = 2e-20 Identities = 47/71 (66%), Positives = 61/71 (85%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 FE+A ++FDMLGNSM PD+LTYKTLLEGL R+G+ ++AFELLE+ RKKD +G++ YKT Sbjct: 323 FEEATKILFDMLGNSMAPDLLTYKTLLEGLSREGKCNDAFELLEDLRKKDAWMGEKTYKT 382 Query: 308 LLNGLHFLNQE 276 L+ GLHFL+QE Sbjct: 383 LVKGLHFLSQE 393 >ref|XP_011024593.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Populus euphratica] Length = 387 Score = 103 bits (258), Expect = 4e-20 Identities = 46/71 (64%), Positives = 63/71 (88%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 FE+AI +V DMLG+SM PD+LTY+T+LEGLCR+G +AFELLEE+RKKD +G++NYK+ Sbjct: 317 FEEAIGVVVDMLGDSMSPDLLTYRTVLEGLCREGMVDKAFELLEEWRKKDGFMGEKNYKS 376 Query: 308 LLNGLHFLNQE 276 LLNGLHF++++ Sbjct: 377 LLNGLHFVSRQ 387 >ref|XP_010069616.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Eucalyptus grandis] gi|629092029|gb|KCW58024.1| hypothetical protein EUGRSUZ_H00752 [Eucalyptus grandis] Length = 379 Score = 103 bits (258), Expect = 4e-20 Identities = 46/71 (64%), Positives = 60/71 (84%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 FE+A VFDML +M PD+LTYKTLLEGLCR+G+GSEAF+LLEEFRK D ++G +N+K Sbjct: 309 FEEATEAVFDMLREAMAPDLLTYKTLLEGLCREGKGSEAFDLLEEFRKMDTMMGQKNHKI 368 Query: 308 LLNGLHFLNQE 276 LLNG++F+ +E Sbjct: 369 LLNGINFITRE 379 >ref|XP_008356253.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Malus domestica] Length = 370 Score = 102 bits (255), Expect = 9e-20 Identities = 47/72 (65%), Positives = 60/72 (83%), Gaps = 1/72 (1%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDV-VLGDRNYK 312 ++DAI +V DML N+M PD+LTYKTLLEGLCRDG+G EAF+LLE+ R+KD ++ +R YK Sbjct: 299 YDDAIEVVLDMLSNAMSPDLLTYKTLLEGLCRDGKGVEAFDLLEDLRRKDAGMMNERTYK 358 Query: 311 TLLNGLHFLNQE 276 TLLN LHF+N E Sbjct: 359 TLLNALHFVNXE 370 >ref|XP_012833555.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Erythranthe guttatus] gi|604341286|gb|EYU40638.1| hypothetical protein MIMGU_mgv1a007674mg [Erythranthe guttata] Length = 399 Score = 102 bits (255), Expect = 9e-20 Identities = 45/71 (63%), Positives = 57/71 (80%) Frame = -3 Query: 488 FEDAINLVFDMLGNSMGPDMLTYKTLLEGLCRDGRGSEAFELLEEFRKKDVVLGDRNYKT 309 F+D+I FDML NSM PD+LTYKTLLE +CRDG+G EAFELL+ FRK+D + +R Y T Sbjct: 328 FQDSIETAFDMLANSMSPDLLTYKTLLEEMCRDGKGDEAFELLDAFRKRDTFMNERTYNT 387 Query: 308 LLNGLHFLNQE 276 LL+ LHFLN++ Sbjct: 388 LLSALHFLNRD 398