BLASTX nr result
ID: Zanthoxylum22_contig00035646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00035646 (330 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO83114.1| hypothetical protein CISIN_1g045475mg, partial [C... 58 3e-06 ref|XP_006483045.1| PREDICTED: uncharacterized protein LOC102612... 58 3e-06 ref|XP_006483044.1| PREDICTED: uncharacterized protein LOC102612... 58 3e-06 ref|XP_006438815.1| hypothetical protein CICLE_v10033760mg, part... 58 3e-06 >gb|KDO83114.1| hypothetical protein CISIN_1g045475mg, partial [Citrus sinensis] Length = 662 Score = 57.8 bits (138), Expect = 3e-06 Identities = 33/61 (54%), Positives = 40/61 (65%), Gaps = 11/61 (18%) Frame = -2 Query: 152 APWQYSQTPVSTRTEFKTSDKDKPSV-----------IK*YTISEFDKRSQEETTSEDRS 6 AP ++S+TPVS++ E KTSDKDK +V K ISEFDKR QEE+ SEDRS Sbjct: 515 APRRHSKTPVSSKKESKTSDKDKSNVHQILKGGECSSFKMEYISEFDKRLQEESASEDRS 574 Query: 5 C 3 C Sbjct: 575 C 575 >ref|XP_006483045.1| PREDICTED: uncharacterized protein LOC102612384 isoform X2 [Citrus sinensis] Length = 800 Score = 57.8 bits (138), Expect = 3e-06 Identities = 33/61 (54%), Positives = 40/61 (65%), Gaps = 11/61 (18%) Frame = -2 Query: 152 APWQYSQTPVSTRTEFKTSDKDKPSV-----------IK*YTISEFDKRSQEETTSEDRS 6 AP ++S+TPVS++ E KTSDKDK +V K ISEFDKR QEE+ SEDRS Sbjct: 566 APRRHSKTPVSSKKESKTSDKDKSNVHQILKGGECSSFKMEYISEFDKRLQEESASEDRS 625 Query: 5 C 3 C Sbjct: 626 C 626 >ref|XP_006483044.1| PREDICTED: uncharacterized protein LOC102612384 isoform X1 [Citrus sinensis] Length = 806 Score = 57.8 bits (138), Expect = 3e-06 Identities = 33/61 (54%), Positives = 40/61 (65%), Gaps = 11/61 (18%) Frame = -2 Query: 152 APWQYSQTPVSTRTEFKTSDKDKPSV-----------IK*YTISEFDKRSQEETTSEDRS 6 AP ++S+TPVS++ E KTSDKDK +V K ISEFDKR QEE+ SEDRS Sbjct: 572 APRRHSKTPVSSKKESKTSDKDKSNVHQILKGGECSSFKMEYISEFDKRLQEESASEDRS 631 Query: 5 C 3 C Sbjct: 632 C 632 >ref|XP_006438815.1| hypothetical protein CICLE_v10033760mg, partial [Citrus clementina] gi|557541011|gb|ESR52055.1| hypothetical protein CICLE_v10033760mg, partial [Citrus clementina] Length = 662 Score = 57.8 bits (138), Expect = 3e-06 Identities = 33/61 (54%), Positives = 40/61 (65%), Gaps = 11/61 (18%) Frame = -2 Query: 152 APWQYSQTPVSTRTEFKTSDKDKPSV-----------IK*YTISEFDKRSQEETTSEDRS 6 AP ++S+TPVS++ E KTSDKDK +V K ISEFDKR QEE+ SEDRS Sbjct: 572 APRRHSKTPVSSKKESKTSDKDKSNVHQILKGGECSSFKMEYISEFDKRLQEESASEDRS 631 Query: 5 C 3 C Sbjct: 632 C 632