BLASTX nr result
ID: Zanthoxylum22_contig00035524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00035524 (350 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO49317.1| hypothetical protein CISIN_1g017508mg [Citrus sin... 57 7e-06 ref|XP_006428393.1| hypothetical protein CICLE_v10012002mg [Citr... 57 7e-06 >gb|KDO49317.1| hypothetical protein CISIN_1g017508mg [Citrus sinensis] Length = 370 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 348 ASFGWDGEKDDRKRRAEFILKQSIENPQELTQL 250 ASF D EKDD+KRRAEFILKQSIENPQEL+QL Sbjct: 338 ASFWRDEEKDDKKRRAEFILKQSIENPQELSQL 370 >ref|XP_006428393.1| hypothetical protein CICLE_v10012002mg [Citrus clementina] gi|568880174|ref|XP_006493009.1| PREDICTED: transcription initiation factor TFIID subunit 8-like [Citrus sinensis] gi|568885488|ref|XP_006495304.1| PREDICTED: transcription initiation factor TFIID subunit 8-like [Citrus sinensis] gi|557530450|gb|ESR41633.1| hypothetical protein CICLE_v10012002mg [Citrus clementina] Length = 370 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 348 ASFGWDGEKDDRKRRAEFILKQSIENPQELTQL 250 ASF D EKDD+KRRAEFILKQSIENPQEL+QL Sbjct: 338 ASFWRDEEKDDKKRRAEFILKQSIENPQELSQL 370