BLASTX nr result
ID: Zanthoxylum22_contig00035444
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00035444 (303 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007014225.1| Uncharacterized protein TCM_039130 [Theobrom... 63 8e-08 gb|KRG91124.1| hypothetical protein GLYMA_20G134800 [Glycine max] 57 5e-06 >ref|XP_007014225.1| Uncharacterized protein TCM_039130 [Theobroma cacao] gi|508784588|gb|EOY31844.1| Uncharacterized protein TCM_039130 [Theobroma cacao] Length = 147 Score = 63.2 bits (152), Expect = 8e-08 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = -3 Query: 196 KTIKGWGIPRIELGTSRTQSENHTTRPNAHLLFVMVCF*LIPFTPI 59 K KGWGIPRIELGTS TQSEN TTRPNA L ++V F F+P+ Sbjct: 82 KRNKGWGIPRIELGTSHTQSENQTTRPNAQLFMIVVFFMYFWFSPM 127 >gb|KRG91124.1| hypothetical protein GLYMA_20G134800 [Glycine max] Length = 115 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 210 WNQRLKQ*KDGAFRESNSGPLAPKARIIPLDQMPT 106 W Q+ + K GAFRESNSGPLAPKARIIPLDQMPT Sbjct: 27 WGQKYE--KMGAFRESNSGPLAPKARIIPLDQMPT 59