BLASTX nr result
ID: Zanthoxylum22_contig00035049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00035049 (309 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM40671.1| hypothetical protein TCE0_039f13199 [Talaromyces... 62 2e-07 ref|XP_002485000.1| conserved hypothetical protein [Talaromyces ... 62 2e-07 emb|CRG83217.1| hypothetical protein PISL3812_00568 [Talaromyces... 58 3e-06 >dbj|GAM40671.1| hypothetical protein TCE0_039f13199 [Talaromyces cellulolyticus] Length = 102 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/49 (61%), Positives = 38/49 (77%) Frame = -2 Query: 308 KAITDAGGKITHEYNLFKGFAAKCSDKAVEELKALKGLAEQYIPVVEED 162 KAITDAGG ITHE+NLFKGFAAK S A+E ++A + ++PV+EED Sbjct: 46 KAITDAGGWITHEFNLFKGFAAKASSSAIETIQA---SSTNFLPVIEED 91 >ref|XP_002485000.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218715625|gb|EED15047.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 103 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/49 (61%), Positives = 38/49 (77%) Frame = -2 Query: 308 KAITDAGGKITHEYNLFKGFAAKCSDKAVEELKALKGLAEQYIPVVEED 162 KAITDAGG ITHE+NLFKGFAAK S A+E ++A + ++PV+EED Sbjct: 46 KAITDAGGWITHEFNLFKGFAAKASSSAIETIQA---SSTNFLPVIEED 91 >emb|CRG83217.1| hypothetical protein PISL3812_00568 [Talaromyces islandicus] Length = 102 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = -2 Query: 308 KAITDAGGKITHEYNLFKGFAAKCSDKAVEELKALKGLAEQYIPVVEED 162 K ITDAGG ITHEYNLFKGFAAK + A L+ + + ++PV+EED Sbjct: 45 KTITDAGGWITHEYNLFKGFAAKATSNA---LQTISTTSTNFLPVIEED 90