BLASTX nr result
ID: Zanthoxylum22_contig00034909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00034909 (318 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006467049.1| PREDICTED: pentatricopeptide repeat-containi... 89 2e-15 ref|XP_006425315.1| hypothetical protein CICLE_v10025555mg [Citr... 89 2e-15 ref|XP_011022210.1| PREDICTED: pentatricopeptide repeat-containi... 82 2e-13 ref|XP_012065351.1| PREDICTED: pentatricopeptide repeat-containi... 82 2e-13 ref|XP_002306437.1| pentatricopeptide repeat-containing family p... 82 2e-13 ref|XP_012469249.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_007046551.1| Tetratricopeptide repeat (TPR)-like superfam... 79 1e-12 gb|KNA17987.1| hypothetical protein SOVF_074820 [Spinacia oleracea] 79 1e-12 ref|XP_009350969.1| PREDICTED: pentatricopeptide repeat-containi... 78 2e-12 ref|XP_008393571.1| PREDICTED: pentatricopeptide repeat-containi... 78 2e-12 ref|XP_008241978.1| PREDICTED: pentatricopeptide repeat-containi... 78 2e-12 ref|XP_007204185.1| hypothetical protein PRUPE_ppa015299mg [Prun... 78 2e-12 ref|XP_014515774.1| PREDICTED: pentatricopeptide repeat-containi... 78 3e-12 emb|CDP19984.1| unnamed protein product [Coffea canephora] 78 3e-12 ref|XP_007134550.1| hypothetical protein PHAVU_010G056500g [Phas... 78 3e-12 ref|XP_010242844.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-12 ref|XP_010030853.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 77 4e-12 ref|XP_002521681.1| pentatricopeptide repeat-containing protein,... 77 4e-12 gb|KRH48741.1| hypothetical protein GLYMA_07G109000 [Glycine max] 77 5e-12 ref|XP_010683001.1| PREDICTED: pentatricopeptide repeat-containi... 77 7e-12 >ref|XP_006467049.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670-like isoform X1 [Citrus sinensis] gi|568825365|ref|XP_006467050.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670-like isoform X2 [Citrus sinensis] gi|568825367|ref|XP_006467051.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670-like isoform X3 [Citrus sinensis] Length = 465 Score = 88.6 bits (218), Expect = 2e-15 Identities = 45/50 (90%), Positives = 46/50 (92%) Frame = -3 Query: 316 EGGVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 EGGVKLE AAYATLV+ALCR GKVAEAYEVFDYAVE KSLTDVAAYT LE Sbjct: 400 EGGVKLETAAYATLVRALCRHGKVAEAYEVFDYAVESKSLTDVAAYTTLE 449 >ref|XP_006425315.1| hypothetical protein CICLE_v10025555mg [Citrus clementina] gi|557527305|gb|ESR38555.1| hypothetical protein CICLE_v10025555mg [Citrus clementina] Length = 465 Score = 88.6 bits (218), Expect = 2e-15 Identities = 45/50 (90%), Positives = 46/50 (92%) Frame = -3 Query: 316 EGGVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 EGGVKLE AAYATLV+ALCR GKVAEAYEVFDYAVE KSLTDVAAYT LE Sbjct: 400 EGGVKLETAAYATLVRALCRHGKVAEAYEVFDYAVESKSLTDVAAYTTLE 449 >ref|XP_011022210.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Populus euphratica] gi|743824325|ref|XP_011022211.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Populus euphratica] gi|743824329|ref|XP_011022212.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Populus euphratica] gi|743824332|ref|XP_011022213.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Populus euphratica] gi|743824334|ref|XP_011022215.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Populus euphratica] Length = 462 Score = 82.0 bits (201), Expect = 2e-13 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -3 Query: 316 EGGVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 +GG+KLE A+YAT V+ALCR G+VAEAYEVFDYAVE KSLTDVAAYT LE Sbjct: 397 KGGMKLETASYATFVRALCREGRVAEAYEVFDYAVESKSLTDVAAYTTLE 446 >ref|XP_012065351.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Jatropha curcas] gi|802555289|ref|XP_012065352.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Jatropha curcas] gi|643737685|gb|KDP43734.1| hypothetical protein JCGZ_22361 [Jatropha curcas] Length = 467 Score = 82.0 bits (201), Expect = 2e-13 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = -3 Query: 316 EGGVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 EG +KLE A+YAT V+ALCR GKVAEAYEVFDYAVE KSLTDVAAYT LE Sbjct: 402 EGDMKLETASYATFVRALCREGKVAEAYEVFDYAVESKSLTDVAAYTTLE 451 >ref|XP_002306437.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222855886|gb|EEE93433.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 462 Score = 82.0 bits (201), Expect = 2e-13 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -3 Query: 316 EGGVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 +GG+KLE A+YAT V+ALCR G+VAEAYEVFDYAVE KSLTDVAAYT LE Sbjct: 397 KGGMKLETASYATFVRALCREGRVAEAYEVFDYAVESKSLTDVAAYTTLE 446 >ref|XP_012469249.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Gossypium raimondii] gi|763750142|gb|KJB17530.1| hypothetical protein B456_003G004000 [Gossypium raimondii] gi|763750143|gb|KJB17531.1| hypothetical protein B456_003G004000 [Gossypium raimondii] Length = 461 Score = 79.3 bits (194), Expect = 1e-12 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -3 Query: 310 GVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 G+KLE A+YATLV+ALCR G+VAEAYEVFDYAVE KSLTDVAAY+ LE Sbjct: 398 GMKLETASYATLVRALCREGRVAEAYEVFDYAVESKSLTDVAAYSTLE 445 >ref|XP_007046551.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508698812|gb|EOX90708.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 464 Score = 79.3 bits (194), Expect = 1e-12 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -3 Query: 310 GVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 G+ LEKA+YATLV+ALCR G+VAEAYEVFDYAVE KSLTDVAAY+ LE Sbjct: 401 GMMLEKASYATLVRALCREGRVAEAYEVFDYAVESKSLTDVAAYSTLE 448 >gb|KNA17987.1| hypothetical protein SOVF_074820 [Spinacia oleracea] Length = 464 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -3 Query: 316 EGGVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 EGGV+LE A+YAT ++ LCR G+V EAYEVFDYAVE KSLTDVAAYT LE Sbjct: 399 EGGVQLESASYATCLRGLCREGRVGEAYEVFDYAVETKSLTDVAAYTTLE 448 >ref|XP_009350969.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Pyrus x bretschneideri] gi|694451735|ref|XP_009350970.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Pyrus x bretschneideri] Length = 465 Score = 78.2 bits (191), Expect = 2e-12 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -3 Query: 316 EGGVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 E G+KL+ A+YATLV+ALCR G+VA+AYEVFDYAVE KS+TDVAAYT LE Sbjct: 400 ECGMKLDTASYATLVRALCREGRVADAYEVFDYAVESKSVTDVAAYTTLE 449 >ref|XP_008393571.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Malus domestica] Length = 465 Score = 78.2 bits (191), Expect = 2e-12 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -3 Query: 316 EGGVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 E G+KL+ A+YATLV+ALCR G+VA+AYEVFDYAVE KS+TDVAAYT LE Sbjct: 400 ECGMKLDTASYATLVRALCREGRVADAYEVFDYAVESKSVTDVAAYTTLE 449 >ref|XP_008241978.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Prunus mume] Length = 464 Score = 78.2 bits (191), Expect = 2e-12 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -3 Query: 316 EGGVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 E G+KL+ A+YATLV+ALCR G+VA+AYEVFDYAVE KS+TDVAAYT LE Sbjct: 399 ECGMKLDTASYATLVRALCREGRVADAYEVFDYAVESKSVTDVAAYTTLE 448 >ref|XP_007204185.1| hypothetical protein PRUPE_ppa015299mg [Prunus persica] gi|462399716|gb|EMJ05384.1| hypothetical protein PRUPE_ppa015299mg [Prunus persica] Length = 464 Score = 78.2 bits (191), Expect = 2e-12 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -3 Query: 316 EGGVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 E G+KL+ A+YATLV+ALCR G+VA+AYEVFDYAVE KS+TDVAAYT LE Sbjct: 399 ECGMKLDTASYATLVRALCREGRVADAYEVFDYAVESKSVTDVAAYTTLE 448 >ref|XP_014515774.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Vigna radiata var. radiata] Length = 460 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -3 Query: 316 EGGVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 EGG+KL+ A+Y TLV+ALCR G+VAEAYEVFDYAV KSLTDVAAY LE Sbjct: 395 EGGLKLDTASYGTLVRALCRDGRVAEAYEVFDYAVASKSLTDVAAYLTLE 444 >emb|CDP19984.1| unnamed protein product [Coffea canephora] Length = 466 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = -3 Query: 316 EGGVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 EGG+KLE Y T V+ALCR G+VAEAYEVFDYAVE KS+TDVAAY+ LE Sbjct: 401 EGGMKLETGCYGTFVRALCRKGRVAEAYEVFDYAVESKSMTDVAAYSTLE 450 >ref|XP_007134550.1| hypothetical protein PHAVU_010G056500g [Phaseolus vulgaris] gi|561007595|gb|ESW06544.1| hypothetical protein PHAVU_010G056500g [Phaseolus vulgaris] Length = 462 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -3 Query: 316 EGGVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 EGG+K + A+Y T V+ALCR G+VAEAYEVFDYAVE KSLTDVAAY+ LE Sbjct: 397 EGGLKFDTASYGTFVRALCRDGRVAEAYEVFDYAVESKSLTDVAAYSTLE 446 >ref|XP_010242844.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Nelumbo nucifera] Length = 478 Score = 77.4 bits (189), Expect = 4e-12 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -3 Query: 313 GGVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 GG+KLE A+YATLV+ALCR K+AEAYEVFDYAV+ KSLTDV AY+ LE Sbjct: 414 GGMKLEAASYATLVRALCRDNKIAEAYEVFDYAVQSKSLTDVVAYSTLE 462 >ref|XP_010030853.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g17670 [Eucalyptus grandis] Length = 459 Score = 77.4 bits (189), Expect = 4e-12 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -3 Query: 313 GGVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 G +KLE AAYAT V++LCR G+VAE YEVFDYAVE KSLTDVAAYT LE Sbjct: 395 GXMKLETAAYATFVRSLCRDGRVAEVYEVFDYAVESKSLTDVAAYTTLE 443 >ref|XP_002521681.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539072|gb|EEF40668.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 458 Score = 77.4 bits (189), Expect = 4e-12 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -3 Query: 316 EGGVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 EGG+ L+ A+YAT V+ALCR GKVAEAYEVFDYAVE KSLT+ AAYT LE Sbjct: 393 EGGMLLDTASYATFVRALCREGKVAEAYEVFDYAVESKSLTNAAAYTTLE 442 >gb|KRH48741.1| hypothetical protein GLYMA_07G109000 [Glycine max] Length = 316 Score = 77.0 bits (188), Expect = 5e-12 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -3 Query: 313 GGVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 GG+KL+ A+Y T V+ALCR G++AEAYEVFDYAVE KSLTDVAAY+ LE Sbjct: 252 GGLKLDTASYGTFVRALCRDGRIAEAYEVFDYAVESKSLTDVAAYSTLE 300 >ref|XP_010683001.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Beta vulgaris subsp. vulgaris] gi|870855149|gb|KMT06882.1| hypothetical protein BVRB_6g152210 [Beta vulgaris subsp. vulgaris] Length = 470 Score = 76.6 bits (187), Expect = 7e-12 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = -3 Query: 313 GGVKLEKAAYATLVKALCRIGKVAEAYEVFDYAVERKSLTDVAAYTMLE 167 GGVKLE A+YAT ++ALCR G+ AEAYEVFDYAVE KSLTD AAY+ LE Sbjct: 406 GGVKLETASYATFLRALCREGRAAEAYEVFDYAVESKSLTDFAAYSTLE 454