BLASTX nr result
ID: Zanthoxylum22_contig00034889
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00034889 (279 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006445262.1| hypothetical protein CICLE_v10020183mg [Citr... 59 1e-06 >ref|XP_006445262.1| hypothetical protein CICLE_v10020183mg [Citrus clementina] gi|568875680|ref|XP_006490920.1| PREDICTED: transducin beta-like protein 2-like [Citrus sinensis] gi|557547524|gb|ESR58502.1| hypothetical protein CICLE_v10020183mg [Citrus clementina] gi|641867139|gb|KDO85823.1| hypothetical protein CISIN_1g013578mg [Citrus sinensis] Length = 440 Score = 58.9 bits (141), Expect = 1e-06 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 60 MDAVLSITLVSVVLGALIASIFFKSYYFSKRRSELQSIAAPE 185 MD VLSIT+VSVVLGALIA IFFKS YF+KRRSE++SIA E Sbjct: 1 MDPVLSITVVSVVLGALIAIIFFKS-YFTKRRSEIKSIAKTE 41