BLASTX nr result
ID: Zanthoxylum22_contig00034859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00034859 (504 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007050539.1| Pentatricopeptide repeat (PPR) superfamily p... 128 2e-27 ref|XP_012473539.1| PREDICTED: pentatricopeptide repeat-containi... 125 9e-27 ref|XP_012081319.1| PREDICTED: pentatricopeptide repeat-containi... 125 1e-26 ref|XP_012081318.1| PREDICTED: pentatricopeptide repeat-containi... 125 1e-26 ref|XP_012081315.1| PREDICTED: pentatricopeptide repeat-containi... 125 1e-26 ref|XP_010086604.1| hypothetical protein L484_002429 [Morus nota... 125 2e-26 ref|XP_011084681.1| PREDICTED: pentatricopeptide repeat-containi... 123 5e-26 ref|XP_012084286.1| PREDICTED: pentatricopeptide repeat-containi... 122 8e-26 ref|XP_012084287.1| PREDICTED: pentatricopeptide repeat-containi... 122 8e-26 ref|XP_010065532.1| PREDICTED: pentatricopeptide repeat-containi... 121 2e-25 gb|KCW63064.1| hypothetical protein EUGRSUZ_G00655 [Eucalyptus g... 121 2e-25 emb|CBI28722.3| unnamed protein product [Vitis vinifera] 121 2e-25 ref|XP_003632339.1| PREDICTED: pentatricopeptide repeat-containi... 121 2e-25 gb|KNA23768.1| hypothetical protein SOVF_022320 [Spinacia oleracea] 121 2e-25 ref|XP_011032661.1| PREDICTED: pentatricopeptide repeat-containi... 121 2e-25 emb|CDP00987.1| unnamed protein product [Coffea canephora] 121 2e-25 ref|XP_008451294.1| PREDICTED: pentatricopeptide repeat-containi... 120 3e-25 ref|XP_006444032.1| hypothetical protein CICLE_v10018932mg [Citr... 120 3e-25 ref|XP_002306785.2| hypothetical protein POPTR_0005s23410g [Popu... 120 3e-25 ref|XP_009775482.1| PREDICTED: pentatricopeptide repeat-containi... 120 5e-25 >ref|XP_007050539.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508702800|gb|EOX94696.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 780 Score = 128 bits (321), Expect = 2e-27 Identities = 58/66 (87%), Positives = 63/66 (95%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFF RANEVVD+MEKGNMF+DKYKYRTLFLKYHKTLYKGKAPK QTEAQ KKREAAL+FK Sbjct: 715 GFFVRANEVVDVMEKGNMFIDKYKYRTLFLKYHKTLYKGKAPKFQTEAQLKKREAALTFK 774 Query: 322 KWIGLF 305 KW+GL+ Sbjct: 775 KWVGLY 780 >ref|XP_012473539.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Gossypium raimondii] gi|763755260|gb|KJB22591.1| hypothetical protein B456_004G055800 [Gossypium raimondii] Length = 778 Score = 125 bits (315), Expect = 9e-27 Identities = 58/65 (89%), Positives = 61/65 (93%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFF RANEVVDMMEKGNMF+DKYKYRTL+LKYHKTLYKGK PK QTE+Q KKREAALSFK Sbjct: 713 GFFIRANEVVDMMEKGNMFIDKYKYRTLYLKYHKTLYKGKTPKFQTESQLKKREAALSFK 772 Query: 322 KWIGL 308 KWIGL Sbjct: 773 KWIGL 777 >ref|XP_012081319.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X3 [Jatropha curcas] Length = 683 Score = 125 bits (314), Expect = 1e-26 Identities = 58/65 (89%), Positives = 61/65 (93%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFF RANEVVDMMEKGNMFVDKYKYRTLFLKYHKTL+KGKAPK QTE+Q KKREA LSFK Sbjct: 619 GFFVRANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLHKGKAPKFQTESQLKKREAVLSFK 678 Query: 322 KWIGL 308 KW+GL Sbjct: 679 KWVGL 683 >ref|XP_012081318.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X2 [Jatropha curcas] Length = 689 Score = 125 bits (314), Expect = 1e-26 Identities = 58/65 (89%), Positives = 61/65 (93%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFF RANEVVDMMEKGNMFVDKYKYRTLFLKYHKTL+KGKAPK QTE+Q KKREA LSFK Sbjct: 625 GFFVRANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLHKGKAPKFQTESQLKKREAVLSFK 684 Query: 322 KWIGL 308 KW+GL Sbjct: 685 KWVGL 689 >ref|XP_012081315.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Jatropha curcas] gi|802667142|ref|XP_012081316.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Jatropha curcas] gi|802667149|ref|XP_012081317.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Jatropha curcas] gi|643718957|gb|KDP30006.1| hypothetical protein JCGZ_18578 [Jatropha curcas] Length = 780 Score = 125 bits (314), Expect = 1e-26 Identities = 58/65 (89%), Positives = 61/65 (93%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFF RANEVVDMMEKGNMFVDKYKYRTLFLKYHKTL+KGKAPK QTE+Q KKREA LSFK Sbjct: 716 GFFVRANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLHKGKAPKFQTESQLKKREAVLSFK 775 Query: 322 KWIGL 308 KW+GL Sbjct: 776 KWVGL 780 >ref|XP_010086604.1| hypothetical protein L484_002429 [Morus notabilis] gi|587831217|gb|EXB22115.1| hypothetical protein L484_002429 [Morus notabilis] Length = 739 Score = 125 bits (313), Expect = 2e-26 Identities = 58/65 (89%), Positives = 61/65 (93%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFF RANEVV+MMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPK QTEAQ KREAAL+FK Sbjct: 674 GFFKRANEVVEMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKFQTEAQLSKREAALAFK 733 Query: 322 KWIGL 308 KW+GL Sbjct: 734 KWVGL 738 >ref|XP_011084681.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Sesamum indicum] gi|747075306|ref|XP_011084682.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Sesamum indicum] Length = 770 Score = 123 bits (309), Expect = 5e-26 Identities = 56/65 (86%), Positives = 61/65 (93%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFF RANEVV+MMEKGNMF+DKYKYR LFLKYHKTLYKGKAPK QTE+Q KKREAAL+FK Sbjct: 706 GFFIRANEVVEMMEKGNMFIDKYKYRALFLKYHKTLYKGKAPKFQTESQLKKREAALAFK 765 Query: 322 KWIGL 308 KW+GL Sbjct: 766 KWVGL 770 >ref|XP_012084286.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Jatropha curcas] Length = 798 Score = 122 bits (307), Expect = 8e-26 Identities = 56/65 (86%), Positives = 60/65 (92%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFF RANEV DMMEKGNMFVDKYKYRTLFLKYHKTL+KGKAPK QTE+Q K+REA LSFK Sbjct: 733 GFFVRANEVADMMEKGNMFVDKYKYRTLFLKYHKTLHKGKAPKFQTESQLKRREAVLSFK 792 Query: 322 KWIGL 308 KW+GL Sbjct: 793 KWVGL 797 >ref|XP_012084287.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X2 [Jatropha curcas] gi|802707297|ref|XP_012084288.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X2 [Jatropha curcas] gi|643715933|gb|KDP27748.1| hypothetical protein JCGZ_19777 [Jatropha curcas] Length = 781 Score = 122 bits (307), Expect = 8e-26 Identities = 56/65 (86%), Positives = 60/65 (92%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFF RANEV DMMEKGNMFVDKYKYRTLFLKYHKTL+KGKAPK QTE+Q K+REA LSFK Sbjct: 716 GFFVRANEVADMMEKGNMFVDKYKYRTLFLKYHKTLHKGKAPKFQTESQLKRREAVLSFK 775 Query: 322 KWIGL 308 KW+GL Sbjct: 776 KWVGL 780 >ref|XP_010065532.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Eucalyptus grandis] Length = 787 Score = 121 bits (304), Expect = 2e-25 Identities = 56/65 (86%), Positives = 60/65 (92%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFFARANEVV MMEKGNMF+DKYKYRTLFLKYHKTLYKGKA K QTEAQ KKREA ++FK Sbjct: 722 GFFARANEVVGMMEKGNMFIDKYKYRTLFLKYHKTLYKGKASKFQTEAQLKKREAGVTFK 781 Query: 322 KWIGL 308 KW+GL Sbjct: 782 KWVGL 786 >gb|KCW63064.1| hypothetical protein EUGRSUZ_G00655 [Eucalyptus grandis] Length = 763 Score = 121 bits (304), Expect = 2e-25 Identities = 56/65 (86%), Positives = 60/65 (92%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFFARANEVV MMEKGNMF+DKYKYRTLFLKYHKTLYKGKA K QTEAQ KKREA ++FK Sbjct: 698 GFFARANEVVGMMEKGNMFIDKYKYRTLFLKYHKTLYKGKASKFQTEAQLKKREAGVTFK 757 Query: 322 KWIGL 308 KW+GL Sbjct: 758 KWVGL 762 >emb|CBI28722.3| unnamed protein product [Vitis vinifera] Length = 1361 Score = 121 bits (304), Expect = 2e-25 Identities = 53/66 (80%), Positives = 62/66 (93%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFF RANEVV+MME+G MF+DKYKYRTLFLKYHKTLYK K PK+QTEAQF++R+AAL+FK Sbjct: 1296 GFFVRANEVVEMMERGKMFIDKYKYRTLFLKYHKTLYKSKPPKVQTEAQFRRRDAALTFK 1355 Query: 322 KWIGLF 305 KW+GLF Sbjct: 1356 KWVGLF 1361 >ref|XP_003632339.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Vitis vinifera] gi|731394889|ref|XP_010651991.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Vitis vinifera] Length = 784 Score = 121 bits (304), Expect = 2e-25 Identities = 53/66 (80%), Positives = 62/66 (93%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFF RANEVV+MME+G MF+DKYKYRTLFLKYHKTLYK K PK+QTEAQF++R+AAL+FK Sbjct: 719 GFFVRANEVVEMMERGKMFIDKYKYRTLFLKYHKTLYKSKPPKVQTEAQFRRRDAALTFK 778 Query: 322 KWIGLF 305 KW+GLF Sbjct: 779 KWVGLF 784 >gb|KNA23768.1| hypothetical protein SOVF_022320 [Spinacia oleracea] Length = 772 Score = 121 bits (303), Expect = 2e-25 Identities = 54/66 (81%), Positives = 61/66 (92%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFF RANEVV+MMEKGNMF+DKY+YRTLFLKYHKTLYKGK PK +TEAQ KKR+A L+FK Sbjct: 707 GFFFRANEVVEMMEKGNMFIDKYRYRTLFLKYHKTLYKGKTPKFETEAQSKKRDATLAFK 766 Query: 322 KWIGLF 305 KW+GLF Sbjct: 767 KWVGLF 772 >ref|XP_011032661.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Populus euphratica] gi|743867180|ref|XP_011032662.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Populus euphratica] gi|743867184|ref|XP_011032664.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Populus euphratica] gi|743867188|ref|XP_011032665.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Populus euphratica] Length = 787 Score = 121 bits (303), Expect = 2e-25 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFF+RANEVVDMMEKG MF+DKYKYRTL+LKYHKTLYKGK PKIQTE+Q KKREAAL+ K Sbjct: 722 GFFSRANEVVDMMEKGKMFIDKYKYRTLYLKYHKTLYKGKTPKIQTESQVKKREAALTLK 781 Query: 322 KWIGL 308 KW+GL Sbjct: 782 KWLGL 786 >emb|CDP00987.1| unnamed protein product [Coffea canephora] Length = 784 Score = 121 bits (303), Expect = 2e-25 Identities = 53/65 (81%), Positives = 62/65 (95%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFF RANEVVDM+E+GN+F+DKY+YRTLFLKYHKTLYKGKAPK QTE+Q K+REAAL+FK Sbjct: 719 GFFIRANEVVDMLERGNLFIDKYRYRTLFLKYHKTLYKGKAPKFQTESQMKRREAALNFK 778 Query: 322 KWIGL 308 KW+GL Sbjct: 779 KWVGL 783 >ref|XP_008451294.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Cucumis melo] gi|659100841|ref|XP_008451295.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Cucumis melo] Length = 786 Score = 120 bits (302), Expect = 3e-25 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFFARANEVV++MEK NMFVDKYKYRTLFLKYH+TLYKGKAPK QTEAQ +KRE AL+FK Sbjct: 721 GFFARANEVVEVMEKDNMFVDKYKYRTLFLKYHRTLYKGKAPKFQTEAQLRKRETALAFK 780 Query: 322 KWIGL 308 KW+GL Sbjct: 781 KWVGL 785 >ref|XP_006444032.1| hypothetical protein CICLE_v10018932mg [Citrus clementina] gi|568852030|ref|XP_006479684.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Citrus sinensis] gi|568852032|ref|XP_006479685.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X2 [Citrus sinensis] gi|557546294|gb|ESR57272.1| hypothetical protein CICLE_v10018932mg [Citrus clementina] gi|641849797|gb|KDO68671.1| hypothetical protein CISIN_1g003946mg [Citrus sinensis] Length = 784 Score = 120 bits (302), Expect = 3e-25 Identities = 56/65 (86%), Positives = 59/65 (90%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFFARANEVV MME+G MF+DKYKYRTLFLKYHKTLYKGK PK QTEAQ KKREAAL FK Sbjct: 719 GFFARANEVVAMMEEGKMFIDKYKYRTLFLKYHKTLYKGKTPKFQTEAQLKKREAALGFK 778 Query: 322 KWIGL 308 KW+GL Sbjct: 779 KWLGL 783 >ref|XP_002306785.2| hypothetical protein POPTR_0005s23410g [Populus trichocarpa] gi|550339593|gb|EEE93781.2| hypothetical protein POPTR_0005s23410g [Populus trichocarpa] Length = 787 Score = 120 bits (302), Expect = 3e-25 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFF+RANEVVDMMEKG MF+DKYKYRTL+LKYHKTLYKGK PKIQTE+ KKREAAL+FK Sbjct: 722 GFFSRANEVVDMMEKGKMFIDKYKYRTLYLKYHKTLYKGKTPKIQTESLVKKREAALTFK 781 Query: 322 KWIGL 308 KW+GL Sbjct: 782 KWLGL 786 >ref|XP_009775482.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450357|ref|XP_009775488.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450364|ref|XP_009775494.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450369|ref|XP_009775502.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450375|ref|XP_009775510.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450381|ref|XP_009775518.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450388|ref|XP_009775522.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450394|ref|XP_009775528.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450400|ref|XP_009775539.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450407|ref|XP_009775545.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450413|ref|XP_009775550.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450419|ref|XP_009775552.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450426|ref|XP_009775561.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450432|ref|XP_009775567.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450438|ref|XP_009775573.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450445|ref|XP_009775578.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450451|ref|XP_009775587.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450457|ref|XP_009775594.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450464|ref|XP_009775597.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450470|ref|XP_009775605.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450476|ref|XP_009775614.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450483|ref|XP_009775620.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450489|ref|XP_009775628.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450495|ref|XP_009775636.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] Length = 776 Score = 120 bits (300), Expect = 5e-25 Identities = 54/65 (83%), Positives = 60/65 (92%) Frame = -3 Query: 502 GFFARANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLYKGKAPKIQTEAQFKKREAALSFK 323 GFF RANEVV+MM+KGNMF+DKYKYRTLFLKYHKTLYKGKAPK Q+E Q KKREAAL+FK Sbjct: 711 GFFVRANEVVEMMDKGNMFIDKYKYRTLFLKYHKTLYKGKAPKFQSETQMKKREAALNFK 770 Query: 322 KWIGL 308 +W GL Sbjct: 771 RWAGL 775