BLASTX nr result
ID: Zanthoxylum22_contig00034551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00034551 (319 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006465305.1| PREDICTED: putative pentatricopeptide repeat... 68 2e-09 ref|XP_006427322.1| hypothetical protein CICLE_v10025000mg [Citr... 64 4e-08 >ref|XP_006465305.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930-like [Citrus sinensis] Length = 741 Score = 68.2 bits (165), Expect = 2e-09 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 4/59 (6%) Frame = -2 Query: 165 MPLSLPTKTHNHNNS-FIFNKMFSNSIASISPPNL---ETPLVSLLETCKSMHQLKQIH 1 M LS P++TH + IFNKMFSNS SISPP+ ETPL+SL+ETC+SMHQLKQIH Sbjct: 1 MTLSFPSRTHVLKKTPIIFNKMFSNS--SISPPSTLTQETPLISLIETCESMHQLKQIH 57 >ref|XP_006427322.1| hypothetical protein CICLE_v10025000mg [Citrus clementina] gi|557529312|gb|ESR40562.1| hypothetical protein CICLE_v10025000mg [Citrus clementina] Length = 728 Score = 63.9 bits (154), Expect = 4e-08 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 4/59 (6%) Frame = -2 Query: 165 MPLSLPTKTHNHNNSFI-FNKMFSNSIASISPPNL---ETPLVSLLETCKSMHQLKQIH 1 M LS P++TH + I FNKMFSNS SISPP+ ETPL+S +ETC+SMHQLKQIH Sbjct: 1 MTLSFPSRTHVLKKTPITFNKMFSNS--SISPPSTLTQETPLISPIETCESMHQLKQIH 57