BLASTX nr result
ID: Zanthoxylum22_contig00034548
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00034548 (385 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO41855.1| hypothetical protein CISIN_1g003569mg [Citrus sin... 52 9e-09 ref|XP_006447598.1| hypothetical protein CICLE_v10014304mg [Citr... 52 9e-09 >gb|KDO41855.1| hypothetical protein CISIN_1g003569mg [Citrus sinensis] Length = 810 Score = 52.4 bits (124), Expect(2) = 9e-09 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +3 Query: 3 SSEVNTMKSEPSSSNRIPDVNAKDVVNPGEATKGGDILSAT 125 S EVN MKSEPS SNRI DV A+D VN G++ K GDILSAT Sbjct: 739 SFEVNIMKSEPSVSNRISDVKAEDGVNAGDSAK-GDILSAT 778 Score = 33.9 bits (76), Expect(2) = 9e-09 Identities = 17/29 (58%), Positives = 22/29 (75%), Gaps = 7/29 (24%) Frame = +1 Query: 142 TDDIETM-------SFMLASNISIPPKQR 207 T+D+ET+ SFMLAS++SIPPKQR Sbjct: 782 TEDLETLMSQMHDLSFMLASDLSIPPKQR 810 >ref|XP_006447598.1| hypothetical protein CICLE_v10014304mg [Citrus clementina] gi|568830757|ref|XP_006469654.1| PREDICTED: uncharacterized protein DDB_G0290685-like [Citrus sinensis] gi|557550209|gb|ESR60838.1| hypothetical protein CICLE_v10014304mg [Citrus clementina] Length = 810 Score = 52.4 bits (124), Expect(2) = 9e-09 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +3 Query: 3 SSEVNTMKSEPSSSNRIPDVNAKDVVNPGEATKGGDILSAT 125 S EVN MKSEPS SNRI DV A+D VN G++ K GDILSAT Sbjct: 739 SFEVNIMKSEPSVSNRISDVKAEDGVNAGDSAK-GDILSAT 778 Score = 33.9 bits (76), Expect(2) = 9e-09 Identities = 17/29 (58%), Positives = 22/29 (75%), Gaps = 7/29 (24%) Frame = +1 Query: 142 TDDIETM-------SFMLASNISIPPKQR 207 T+D+ET+ SFMLAS++SIPPKQR Sbjct: 782 TEDLETLMSQMHDLSFMLASDLSIPPKQR 810