BLASTX nr result
ID: Zanthoxylum22_contig00034509
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00034509 (327 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_064098.1| orf108b gene product (mitochondrion) [Beta vulg... 75 2e-11 >ref|NP_064098.1| orf108b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435122|ref|YP_004222340.1| hypothetical protein BevumaM_p106 [Beta vulgaris subsp. maritima] gi|346683213|ref|YP_004842145.1| hypothetical protein BemaM_p101 [Beta macrocarpa] gi|9087348|dbj|BAA99492.1| orf108b (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|317905676|emb|CBJ14070.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439855|emb|CBJ17560.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148057|emb|CBJ20720.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500131|emb|CBX24950.1| hypothetical protein [Beta macrocarpa] gi|384939122|emb|CBL51968.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 108 Score = 75.1 bits (183), Expect = 2e-11 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = -1 Query: 165 LTSELHKSNHSRKSKLIQQSLFFFTANRAMNSVQSLFSYRK 43 LTSELHKSNHSRKSKLIQQSLFFFTANRAMNSVQS F RK Sbjct: 5 LTSELHKSNHSRKSKLIQQSLFFFTANRAMNSVQSRFCNRK 45