BLASTX nr result
ID: Zanthoxylum22_contig00034222
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00034222 (281 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO54845.1| hypothetical protein CISIN_1g004758mg [Citrus sin... 114 3e-23 ref|XP_006470579.1| PREDICTED: pentatricopeptide repeat-containi... 114 3e-23 ref|XP_006446275.1| hypothetical protein CICLE_v10017597mg [Citr... 114 3e-23 ref|XP_010673747.1| PREDICTED: pentatricopeptide repeat-containi... 102 1e-19 emb|CBI24234.3| unnamed protein product [Vitis vinifera] 100 4e-19 ref|XP_002275790.2| PREDICTED: pentatricopeptide repeat-containi... 100 4e-19 emb|CAN63985.1| hypothetical protein VITISV_001389 [Vitis vinifera] 100 4e-19 ref|XP_012478211.1| PREDICTED: pentatricopeptide repeat-containi... 98 2e-18 ref|XP_007015298.1| Tetratricopeptide repeat (TPR)-like superfam... 96 1e-17 ref|XP_010102101.1| hypothetical protein L484_004640 [Morus nota... 95 2e-17 ref|XP_004491250.1| PREDICTED: pentatricopeptide repeat-containi... 95 2e-17 ref|XP_008232168.1| PREDICTED: pentatricopeptide repeat-containi... 94 3e-17 ref|XP_002527053.1| pentatricopeptide repeat-containing protein,... 89 3e-17 ref|XP_007219118.1| hypothetical protein PRUPE_ppa015795mg, part... 93 7e-17 ref|XP_011015136.1| PREDICTED: pentatricopeptide repeat-containi... 93 9e-17 ref|XP_011024963.1| PREDICTED: pentatricopeptide repeat-containi... 93 9e-17 ref|XP_002299984.2| hypothetical protein POPTR_0001s28320g [Popu... 93 9e-17 ref|XP_003617310.2| PPR containing plant-like protein [Medicago ... 92 1e-16 ref|XP_004139059.1| PREDICTED: pentatricopeptide repeat-containi... 92 1e-16 ref|XP_008450352.1| PREDICTED: pentatricopeptide repeat-containi... 92 2e-16 >gb|KDO54845.1| hypothetical protein CISIN_1g004758mg [Citrus sinensis] gi|641835874|gb|KDO54846.1| hypothetical protein CISIN_1g004758mg [Citrus sinensis] Length = 732 Score = 114 bits (285), Expect = 3e-23 Identities = 56/58 (96%), Positives = 56/58 (96%) Frame = -3 Query: 174 RTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRSG 1 RTYVQARKLRE SE FRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRSG Sbjct: 178 RTYVQARKLREGSEVFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRSG 235 >ref|XP_006470579.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like [Citrus sinensis] Length = 752 Score = 114 bits (285), Expect = 3e-23 Identities = 56/58 (96%), Positives = 56/58 (96%) Frame = -3 Query: 174 RTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRSG 1 RTYVQARKLRE SE FRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRSG Sbjct: 198 RTYVQARKLREGSEVFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRSG 255 >ref|XP_006446275.1| hypothetical protein CICLE_v10017597mg [Citrus clementina] gi|557548886|gb|ESR59515.1| hypothetical protein CICLE_v10017597mg [Citrus clementina] Length = 732 Score = 114 bits (285), Expect = 3e-23 Identities = 56/58 (96%), Positives = 56/58 (96%) Frame = -3 Query: 174 RTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRSG 1 RTYVQARKLRE SE FRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRSG Sbjct: 178 RTYVQARKLREGSEVFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRSG 235 >ref|XP_010673747.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 isoform X3 [Beta vulgaris subsp. vulgaris] Length = 637 Score = 102 bits (254), Expect = 1e-19 Identities = 45/75 (60%), Positives = 64/75 (85%) Frame = -3 Query: 225 VSVRIFHS*ENLVEFKTRTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGW 46 +S+++++S +N EF+T T+VQA++LREA+E F++L ++G C SINACNSLLGGLVK+GW Sbjct: 66 ISIKLYNSRQNPAEFETWTFVQAKRLREAAEVFKMLISRGFCVSINACNSLLGGLVKVGW 125 Query: 45 VDLAREVYAEVVRSG 1 VDL E+Y EVVR+G Sbjct: 126 VDLVWEIYKEVVRNG 140 >emb|CBI24234.3| unnamed protein product [Vitis vinifera] Length = 589 Score = 100 bits (249), Expect = 4e-19 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = -3 Query: 174 RTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRSG 1 RTYVQARKLRE EAFR+L++KG+C SINACNSLLGGLVK+GWVDLA E+Y EVVRSG Sbjct: 35 RTYVQARKLREGCEAFRVLKSKGLCVSINACNSLLGGLVKVGWVDLAWEIYQEVVRSG 92 >ref|XP_002275790.2| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Vitis vinifera] gi|731393517|ref|XP_010651510.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Vitis vinifera] gi|731393519|ref|XP_010651511.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Vitis vinifera] gi|731393521|ref|XP_010651512.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Vitis vinifera] Length = 746 Score = 100 bits (249), Expect = 4e-19 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = -3 Query: 174 RTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRSG 1 RTYVQARKLRE EAFR+L++KG+C SINACNSLLGGLVK+GWVDLA E+Y EVVRSG Sbjct: 192 RTYVQARKLREGCEAFRVLKSKGLCVSINACNSLLGGLVKVGWVDLAWEIYQEVVRSG 249 >emb|CAN63985.1| hypothetical protein VITISV_001389 [Vitis vinifera] Length = 850 Score = 100 bits (249), Expect = 4e-19 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = -3 Query: 174 RTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRSG 1 RTYVQARKLRE EAFR+L++KG+C SINACNSLLGGLVK+GWVDLA E+Y EVVRSG Sbjct: 296 RTYVQARKLREGCEAFRVLKSKGLCVSINACNSLLGGLVKVGWVDLAWEIYQEVVRSG 353 >ref|XP_012478211.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Gossypium raimondii] gi|823124040|ref|XP_012478221.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Gossypium raimondii] gi|823124042|ref|XP_012478228.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Gossypium raimondii] gi|763741815|gb|KJB09314.1| hypothetical protein B456_001G134400 [Gossypium raimondii] gi|763741816|gb|KJB09315.1| hypothetical protein B456_001G134400 [Gossypium raimondii] gi|763741817|gb|KJB09316.1| hypothetical protein B456_001G134400 [Gossypium raimondii] Length = 712 Score = 98.2 bits (243), Expect = 2e-18 Identities = 49/70 (70%), Positives = 57/70 (81%) Frame = -3 Query: 210 FHS*ENLVEFKTRTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLAR 31 F S ++ + R+YVQARKLRE SEAF +LR+KG C SINACNSLLGGLVKIGWVDLA Sbjct: 146 FGSNGSVFDLLIRSYVQARKLREGSEAFMILRSKGFCVSINACNSLLGGLVKIGWVDLAW 205 Query: 30 EVYAEVVRSG 1 +VY EVVR+G Sbjct: 206 QVYNEVVRTG 215 >ref|XP_007015298.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590584881|ref|XP_007015299.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590584884|ref|XP_007015300.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508785661|gb|EOY32917.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508785662|gb|EOY32918.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508785663|gb|EOY32919.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 727 Score = 95.5 bits (236), Expect = 1e-17 Identities = 48/70 (68%), Positives = 54/70 (77%) Frame = -3 Query: 210 FHS*ENLVEFKTRTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLAR 31 F S ++ + RTYVQARKLRE SE FR+LR K C SINACNSLLGGLVKIGWV LA Sbjct: 161 FGSNYSVFDLLIRTYVQARKLREGSEVFRILRRKSFCISINACNSLLGGLVKIGWVALAW 220 Query: 30 EVYAEVVRSG 1 +VY EVVR+G Sbjct: 221 DVYREVVRAG 230 >ref|XP_010102101.1| hypothetical protein L484_004640 [Morus notabilis] gi|587904111|gb|EXB92320.1| hypothetical protein L484_004640 [Morus notabilis] Length = 539 Score = 94.7 bits (234), Expect = 2e-17 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = -3 Query: 174 RTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRSG 1 RTYVQA+KLRE SE F++LR+KG SINACNSLLGGLVK+GWVDLA EVY EVVRSG Sbjct: 254 RTYVQAKKLREGSEVFQMLRSKGFSVSINACNSLLGGLVKVGWVDLAWEVYWEVVRSG 311 >ref|XP_004491250.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Cicer arietinum] gi|502098506|ref|XP_004491251.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Cicer arietinum] gi|502098516|ref|XP_004491254.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Cicer arietinum] gi|828296310|ref|XP_012568620.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Cicer arietinum] Length = 707 Score = 94.7 bits (234), Expect = 2e-17 Identities = 43/58 (74%), Positives = 51/58 (87%) Frame = -3 Query: 174 RTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRSG 1 RTYVQARKLRE SEAFR+LR +G C SINACN+LLGG+VK+GWVDLA ++Y + VRSG Sbjct: 153 RTYVQARKLREGSEAFRILRERGFCASINACNALLGGIVKVGWVDLAWKIYEDFVRSG 210 >ref|XP_008232168.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Prunus mume] Length = 700 Score = 94.4 bits (233), Expect = 3e-17 Identities = 45/58 (77%), Positives = 49/58 (84%) Frame = -3 Query: 174 RTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRSG 1 RTYVQARKLRE E F+L R+KG C SINACNSLLGGLVK+GWVDLA +VY EVV SG Sbjct: 146 RTYVQARKLREGFEVFQLFRSKGFCVSINACNSLLGGLVKVGWVDLAWQVYGEVVSSG 203 >ref|XP_002527053.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533615|gb|EEF35353.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 677 Score = 89.0 bits (219), Expect(2) = 3e-17 Identities = 44/67 (65%), Positives = 53/67 (79%), Gaps = 1/67 (1%) Frame = -3 Query: 198 ENLV-EFKTRTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVY 22 +NLV + R+YVQARKL E ++ F++LR KG SINACNSLLGGLVK+GWVDLA EVY Sbjct: 114 DNLVFDLLIRSYVQARKLNEGTDTFKILRRKGFLVSINACNSLLGGLVKMGWVDLAWEVY 173 Query: 21 AEVVRSG 1 E+ RSG Sbjct: 174 NEIARSG 180 Score = 25.8 bits (55), Expect(2) = 3e-17 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = -1 Query: 257 NSNQEQVSSTGSVSESFIVEKILSSLKQ 174 N NQE SS + +SF+VEKIL +L++ Sbjct: 48 NPNQEPTSS--APPDSFLVEKILLNLRR 73 >ref|XP_007219118.1| hypothetical protein PRUPE_ppa015795mg, partial [Prunus persica] gi|462415580|gb|EMJ20317.1| hypothetical protein PRUPE_ppa015795mg, partial [Prunus persica] Length = 512 Score = 93.2 bits (230), Expect = 7e-17 Identities = 44/58 (75%), Positives = 49/58 (84%) Frame = -3 Query: 174 RTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRSG 1 RTYVQARKLRE E F+L R+KG C SINACNSLLGGLVK+GWVDLA +VY +VV SG Sbjct: 55 RTYVQARKLREGFEVFQLFRSKGFCVSINACNSLLGGLVKVGWVDLAWQVYGDVVSSG 112 >ref|XP_011015136.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like [Populus euphratica] gi|743941302|ref|XP_011015137.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like [Populus euphratica] gi|743941304|ref|XP_011015138.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like [Populus euphratica] Length = 739 Score = 92.8 bits (229), Expect = 9e-17 Identities = 49/66 (74%), Positives = 55/66 (83%), Gaps = 1/66 (1%) Frame = -3 Query: 195 NLV-EFKTRTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYA 19 NLV + RTYVQARKLRE +EAFR+LR+KG SINACNSLLGGLVKI WV+LA EV+ Sbjct: 177 NLVFDLLIRTYVQARKLREGTEAFRILRSKGYLVSINACNSLLGGLVKIDWVELAWEVHR 236 Query: 18 EVVRSG 1 EVVRSG Sbjct: 237 EVVRSG 242 >ref|XP_011024963.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like [Populus euphratica] Length = 739 Score = 92.8 bits (229), Expect = 9e-17 Identities = 49/66 (74%), Positives = 55/66 (83%), Gaps = 1/66 (1%) Frame = -3 Query: 195 NLV-EFKTRTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYA 19 NLV + RTYVQARKLRE +EAFR+LR+KG SINACNSLLGGLVKI WV+LA EV+ Sbjct: 177 NLVFDLLIRTYVQARKLREGTEAFRILRSKGYLVSINACNSLLGGLVKIDWVELAWEVHR 236 Query: 18 EVVRSG 1 EVVRSG Sbjct: 237 EVVRSG 242 >ref|XP_002299984.2| hypothetical protein POPTR_0001s28320g [Populus trichocarpa] gi|550348376|gb|EEE84789.2| hypothetical protein POPTR_0001s28320g [Populus trichocarpa] Length = 519 Score = 92.8 bits (229), Expect = 9e-17 Identities = 49/66 (74%), Positives = 55/66 (83%), Gaps = 1/66 (1%) Frame = -3 Query: 195 NLV-EFKTRTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYA 19 NLV + RTYVQARKLRE +EAFR+LR+KG SINACNSLLGGLVKI WV+LA EV+ Sbjct: 48 NLVFDLLIRTYVQARKLREGTEAFRILRSKGYLVSINACNSLLGGLVKIDWVELAWEVHR 107 Query: 18 EVVRSG 1 EVVRSG Sbjct: 108 EVVRSG 113 >ref|XP_003617310.2| PPR containing plant-like protein [Medicago truncatula] gi|657385833|gb|AET00269.2| PPR containing plant-like protein [Medicago truncatula] Length = 730 Score = 92.4 bits (228), Expect = 1e-16 Identities = 46/71 (64%), Positives = 57/71 (80%), Gaps = 2/71 (2%) Frame = -3 Query: 207 HS*ENLVEFKT--RTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLA 34 +S +N+V F RTYVQARKLRE SEAF+LLR +G C SINACN+LLG +VK+GWVDLA Sbjct: 163 NSNQNVVVFDLLIRTYVQARKLREGSEAFQLLRKRGFCVSINACNALLGAIVKVGWVDLA 222 Query: 33 REVYAEVVRSG 1 +VY + V+SG Sbjct: 223 WKVYEDFVKSG 233 >ref|XP_004139059.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Cucumis sativus] gi|778663808|ref|XP_011660161.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Cucumis sativus] Length = 749 Score = 92.4 bits (228), Expect = 1e-16 Identities = 43/64 (67%), Positives = 51/64 (79%) Frame = -3 Query: 192 LVEFKTRTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEV 13 + + RTYVQA+KLRE SEAF++LR KG+ SINACN LLGGLV+ GWVDLA E+Y EV Sbjct: 189 IYDLLVRTYVQAKKLREGSEAFQILRRKGVSVSINACNKLLGGLVRTGWVDLAWEIYGEV 248 Query: 12 VRSG 1 VR G Sbjct: 249 VRGG 252 >ref|XP_008450352.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Cucumis melo] gi|659098926|ref|XP_008450353.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Cucumis melo] gi|659098928|ref|XP_008450354.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Cucumis melo] gi|659098930|ref|XP_008450355.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Cucumis melo] Length = 750 Score = 92.0 bits (227), Expect = 2e-16 Identities = 43/58 (74%), Positives = 49/58 (84%) Frame = -3 Query: 174 RTYVQARKLREASEAFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRSG 1 RTYVQA+KLRE SEAF++LR KG+ SINACN LLGGLV+ GWVDLA E+Y EVVR G Sbjct: 196 RTYVQAKKLREGSEAFQILRRKGVSVSINACNKLLGGLVRTGWVDLAWEIYGEVVRGG 253