BLASTX nr result
ID: Zanthoxylum22_contig00033942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00033942 (291 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO47282.1| hypothetical protein CISIN_1g0166581mg, partial [... 116 7e-24 >gb|KDO47282.1| hypothetical protein CISIN_1g0166581mg, partial [Citrus sinensis] Length = 383 Score = 116 bits (290), Expect = 7e-24 Identities = 66/96 (68%), Positives = 72/96 (75%), Gaps = 1/96 (1%) Frame = -3 Query: 286 PLHGGDLWCLEEVDLLDDHKILLHANA*SPPFVVN*NLLIAELGPLPCRDLLLQLEAVLP 107 P HGGDL LEEVDL DDH+ILLH +A S PFVV+ NLLIAE+ PL DLLL L LP Sbjct: 217 PRHGGDLLDLEEVDLRDDHQILLHVDASSLPFVVDWNLLIAEVRPLRGGDLLLHLGVALP 276 Query: 106 P-HQGGMDLLQGSLLEECMVVLSVGALLFLQGAVHL 2 P H GG+DLLQG L EEC+VV S G LLFLQGAV L Sbjct: 277 PLHLGGIDLLQGPLPEECVVVPSDGVLLFLQGAVRL 312