BLASTX nr result
ID: Zanthoxylum22_contig00033933
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00033933 (843 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAO50902.1| putative uncharacterized protein (mitochondrion)... 60 2e-06 >dbj|BAO50902.1| putative uncharacterized protein (mitochondrion) [Hevea brasiliensis] Length = 129 Score = 60.1 bits (144), Expect = 2e-06 Identities = 30/57 (52%), Positives = 38/57 (66%) Frame = +2 Query: 509 DFKLPGRLTIQDVATQLHLDTGDISILQNIYLDLVNQGIQSPYFVQALDYVLNFPGM 679 D LP + Q+VA ++ +I L IYL+LVNQG QSP+F QALDYVL+F GM Sbjct: 70 DVNLPTGVNPQEVAERVFFSVDNIHWLNQIYLELVNQGTQSPHFAQALDYVLHFGGM 126