BLASTX nr result
ID: Zanthoxylum22_contig00033786
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00033786 (298 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006493354.1| PREDICTED: probable WRKY transcription facto... 58 2e-06 ref|XP_006427622.1| hypothetical protein CICLE_v10026105mg [Citr... 58 2e-06 >ref|XP_006493354.1| PREDICTED: probable WRKY transcription factor 40-like [Citrus sinensis] Length = 319 Score = 58.2 bits (139), Expect = 2e-06 Identities = 33/53 (62%), Positives = 35/53 (66%), Gaps = 12/53 (22%) Frame = -2 Query: 126 MASLSWIDTSLDLNSEPLRLNYEVPAPA------------NKSSVKQETGALL 4 M S SW+DTSLDLNS PLRLN EV APA NK SVKQETGAL+ Sbjct: 1 MDSFSWVDTSLDLNSNPLRLNDEVLAPAKKELQGDFSGFGNKDSVKQETGALV 53 >ref|XP_006427622.1| hypothetical protein CICLE_v10026105mg [Citrus clementina] gi|557529612|gb|ESR40862.1| hypothetical protein CICLE_v10026105mg [Citrus clementina] Length = 318 Score = 58.2 bits (139), Expect = 2e-06 Identities = 33/53 (62%), Positives = 35/53 (66%), Gaps = 12/53 (22%) Frame = -2 Query: 126 MASLSWIDTSLDLNSEPLRLNYEVPAPA------------NKSSVKQETGALL 4 M S SW+DTSLDLNS PLRLN EV APA NK SVKQETGAL+ Sbjct: 1 MDSFSWVDTSLDLNSNPLRLNDEVLAPAKKELQGDFSGFGNKDSVKQETGALV 53