BLASTX nr result
ID: Zanthoxylum22_contig00033492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00033492 (383 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_032789959.1| hypothetical protein [Streptomyces sp. W007] 58 2e-06 >ref|WP_032789959.1| hypothetical protein [Streptomyces sp. W007] Length = 80 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/60 (51%), Positives = 37/60 (61%) Frame = -1 Query: 329 QDKDNKSMTDPGKNVAAGTSGDYRRIVTATGPAATKGSYTATLDPGKQAASTSAGSPSDF 150 +D + + T N AGT GDYRRI TATGPAATKGS T T G++ A GSP+ F Sbjct: 8 RDPNQPAATPTSSNPNAGTGGDYRRIATATGPAATKGSRTPTTGSGEETAED--GSPAAF 65