BLASTX nr result
ID: Zanthoxylum22_contig00033103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00033103 (506 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006433268.1| hypothetical protein CICLE_v10001088mg [Citr... 58 3e-06 >ref|XP_006433268.1| hypothetical protein CICLE_v10001088mg [Citrus clementina] gi|568835914|ref|XP_006471999.1| PREDICTED: receptor-like serine/threonine-protein kinase ALE2-like [Citrus sinensis] gi|557535390|gb|ESR46508.1| hypothetical protein CICLE_v10001088mg [Citrus clementina] Length = 459 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -2 Query: 133 SSKNSHGRSFKDIINSSCRFNAHTTVNFTSSPDVKERCLYGGHV 2 SS++SHG SFKD + S RF AH T+N TSSPDVK C GGHV Sbjct: 77 SSEDSHGSSFKDNKSGSSRFIAHMTINSTSSPDVKGWCFNGGHV 120