BLASTX nr result
ID: Zanthoxylum22_contig00033016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00033016 (385 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY39051.1| putative hydrophobin-like protein [Diaporthe ampe... 65 3e-08 ref|XP_003855192.1| hydrophobin-like protein [Zymoseptoria triti... 61 4e-07 gb|KJX99409.1| hypothetical protein TI39_contig359g00030 [Zymose... 60 6e-07 ref|XP_003852774.1| hypothetical protein MYCGRDRAFT_92962 [Zymos... 60 8e-07 ref|XP_003849870.1| hypothetical protein MYCGRDRAFT_94883 [Zymos... 59 1e-06 ref|XP_008721330.1| hypothetical protein HMPREF1541_08790 [Cyphe... 57 4e-06 >gb|KKY39051.1| putative hydrophobin-like protein [Diaporthe ampelina] Length = 98 Score = 64.7 bits (156), Expect = 3e-08 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 4/84 (4%) Frame = -2 Query: 378 IPSAARSSQICG-KPGYDAGTESFWGS---NVASYAACAKECSKRKQCQSFAYGSGECQL 211 + S A CG GYD G ++++ S ++A++ AC+ C +CQSFA+ S +C L Sbjct: 11 LASRATCEITCGLASGYDRGEKAYFFSGDGSLANFDACSARCQSDSKCQSFAFDSSQCLL 70 Query: 210 YQCSVKSNFVPVADSPYLFYDSSC 139 Y + SNF ++SP+LFYD C Sbjct: 71 YASPLDSNFREQSNSPFLFYDRDC 94 >ref|XP_003855192.1| hydrophobin-like protein [Zymoseptoria tritici IPO323] gi|339475076|gb|EGP90168.1| hydrophobin-like protein [Zymoseptoria tritici IPO323] Length = 463 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/75 (38%), Positives = 38/75 (50%) Frame = -2 Query: 363 RSSQICGKPGYDAGTESFWGSNVASYAACAKECSKRKQCQSFAYGSGECQLYQCSVKSNF 184 RS+ ICG GYD G + + A C+ C K C+S+ YG C+LY +K Sbjct: 27 RSASICGSVGYDQG-KFLLNKPECTIAQCSDLCKKNINCKSYGYGKRTCRLYSKCLKDTV 85 Query: 183 VPVADSPYLFYDSSC 139 P SPY FYD +C Sbjct: 86 KPSKGSPYSFYDRAC 100 >gb|KJX99409.1| hypothetical protein TI39_contig359g00030 [Zymoseptoria brevis] Length = 156 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/81 (35%), Positives = 39/81 (48%) Frame = -2 Query: 381 AIPSAARSSQICGKPGYDAGTESFWGSNVASYAACAKECSKRKQCQSFAYGSGECQLYQC 202 A+ + S CG G D G + S A C C K +C+S+ YG C+LY Sbjct: 26 AVQRSTSSQPACGVVGKDCGKYLLTKAQ-CSVAQCEALCKKNSKCKSYGYGQNTCRLYSA 84 Query: 201 SVKSNFVPVADSPYLFYDSSC 139 +VK N + SPY FYD +C Sbjct: 85 AVKDNVTRKSGSPYKFYDRAC 105 >ref|XP_003852774.1| hypothetical protein MYCGRDRAFT_92962 [Zymoseptoria tritici IPO323] gi|339472655|gb|EGP87750.1| hypothetical protein MYCGRDRAFT_92962 [Zymoseptoria tritici IPO323] Length = 1117 Score = 59.7 bits (143), Expect = 8e-07 Identities = 31/81 (38%), Positives = 42/81 (51%) Frame = -2 Query: 381 AIPSAARSSQICGKPGYDAGTESFWGSNVASYAACAKECSKRKQCQSFAYGSGECQLYQC 202 A P RS+ CG G D+ + + A CA EC K K+CQ+++YG+G C+ Y Sbjct: 20 ATPVDKRSALTCGLHGDDSNRYVIQQTR-CTRANCAIECRKSKKCQAYSYGNGRCRQYSN 78 Query: 201 SVKSNFVPVADSPYLFYDSSC 139 S P SPY FYD +C Sbjct: 79 GCASFIKPNKKSPYAFYDKAC 99 >ref|XP_003849870.1| hypothetical protein MYCGRDRAFT_94883 [Zymoseptoria tritici IPO323] gi|339469748|gb|EGP84846.1| hypothetical protein MYCGRDRAFT_94883 [Zymoseptoria tritici IPO323] Length = 1390 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 1/82 (1%) Frame = -2 Query: 381 AIPSAARSSQICGKPGYD-AGTESFWGSNVASYAACAKECSKRKQCQSFAYGSGECQLYQ 205 A+P+++ + CG GYD + + + +S AAC+ C + +C+S YG C LY Sbjct: 94 ALPASSPPALSCGLVGYDPTKVATQFSTQQSSLAACSSLCKRTSKCKSMRYGRNTCVLYT 153 Query: 204 CSVKSNFVPVADSPYLFYDSSC 139 V F A+SP+ FYD +C Sbjct: 154 APVTGKFSRDANSPFKFYDKAC 175 >ref|XP_008721330.1| hypothetical protein HMPREF1541_08790 [Cyphellophora europaea CBS 101466] gi|568113890|gb|ETN36512.1| hypothetical protein HMPREF1541_08790 [Cyphellophora europaea CBS 101466] Length = 829 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/75 (40%), Positives = 44/75 (58%), Gaps = 2/75 (2%) Frame = -2 Query: 357 SQICGKPGYDAG--TESFWGSNVASYAACAKECSKRKQCQSFAYGSGECQLYQCSVKSNF 184 ++ICG+ GYD G S + +S+A+C CS+ K SFA + +C Y SV NF Sbjct: 452 TEICGQAGYDLGKPAASLVYTGASSFASCKVYCSEFK---SFAVSADQCLCYPRSVDGNF 508 Query: 183 VPVADSPYLFYDSSC 139 V SP++FYD++C Sbjct: 509 NAVESSPFVFYDATC 523