BLASTX nr result
ID: Zanthoxylum22_contig00032414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00032414 (257 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006423157.1| hypothetical protein CICLE_v10029767mg [Citr... 90 6e-16 ref|XP_014493496.1| PREDICTED: mitochondrial import receptor sub... 89 2e-15 ref|XP_010096240.1| hypothetical protein L484_026977 [Morus nota... 89 2e-15 ref|XP_004154290.1| PREDICTED: mitochondrial import receptor sub... 87 4e-15 ref|XP_009798301.1| PREDICTED: mitochondrial import receptor sub... 86 8e-15 ref|XP_012458102.1| PREDICTED: mitochondrial import receptor sub... 86 1e-14 ref|XP_012458101.1| PREDICTED: mitochondrial import receptor sub... 86 1e-14 gb|KHG18108.1| Mitochondrial import receptor subunit TOM6 -like ... 86 1e-14 gb|KHF97675.1| Mitochondrial import receptor subunit TOM6 -like ... 86 1e-14 ref|XP_012069348.1| PREDICTED: mitochondrial import receptor sub... 86 1e-14 ref|XP_007019163.1| Translocase of the outer mitochondrial membr... 86 1e-14 ref|XP_002313822.1| hypothetical protein POPTR_0009s11330g [Popu... 86 1e-14 ref|XP_003541100.1| PREDICTED: mitochondrial import receptor sub... 85 2e-14 ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 f... 85 2e-14 ref|XP_006590915.1| PREDICTED: mitochondrial import receptor sub... 85 2e-14 ref|XP_012836998.1| PREDICTED: mitochondrial import receptor sub... 84 3e-14 ref|XP_009596562.1| PREDICTED: mitochondrial import receptor sub... 84 3e-14 ref|XP_009618631.1| PREDICTED: mitochondrial import receptor sub... 84 3e-14 ref|XP_013456331.1| import receptor subunit TOM6-like protein [M... 84 3e-14 gb|EYU37743.1| hypothetical protein MIMGU_mgv1a016428mg [Erythra... 84 3e-14 >ref|XP_006423157.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|567861008|ref|XP_006423158.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|568851345|ref|XP_006479354.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X1 [Citrus sinensis] gi|568851347|ref|XP_006479355.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Citrus sinensis] gi|557525091|gb|ESR36397.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|557525092|gb|ESR36398.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] Length = 54 Score = 90.1 bits (222), Expect = 6e-16 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLS 252 MFPGMFMKKPDKAAALKQLR+HVAMFGTWVVVIRVTPY+LHY S Sbjct: 1 MFPGMFMKKPDKAAALKQLRSHVAMFGTWVVVIRVTPYLLHYFS 44 >ref|XP_014493496.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Vigna radiata var. radiata] gi|920708858|gb|KOM50855.1| hypothetical protein LR48_Vigan08g168200 [Vigna angularis] Length = 54 Score = 88.6 bits (218), Expect = 2e-15 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLSG 255 MFPGMFM+KPDKAAALKQL++HVAMFG WVVVIRVTPY+LH+LSG Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVAMFGAWVVVIRVTPYVLHFLSG 45 >ref|XP_010096240.1| hypothetical protein L484_026977 [Morus notabilis] gi|587874497|gb|EXB63635.1| hypothetical protein L484_026977 [Morus notabilis] Length = 54 Score = 88.6 bits (218), Expect = 2e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLS 252 MFPGMFM+KPDKAAALKQLRTHVAMFG WV VIRVTPYILHY+S Sbjct: 1 MFPGMFMRKPDKAAALKQLRTHVAMFGAWVAVIRVTPYILHYIS 44 >ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|659118678|ref|XP_008459247.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis melo] gi|659118680|ref|XP_008459248.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis melo] gi|778669220|ref|XP_011649217.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|700206642|gb|KGN61761.1| hypothetical protein Csa_2G238770 [Cucumis sativus] Length = 54 Score = 87.4 bits (215), Expect = 4e-15 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLS 252 MFPGMFM+KPDKAAALKQLR+HVAMFG WV VIRVTPY+LHYLS Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHYLS 44 >ref|XP_009798301.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana sylvestris] Length = 54 Score = 86.3 bits (212), Expect = 8e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLS 252 MFPG+FM+KPDKAAALKQL+THVA+FGTWV VIRVTPYILHY S Sbjct: 1 MFPGLFMRKPDKAAALKQLKTHVALFGTWVAVIRVTPYILHYFS 44 >ref|XP_012458102.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium raimondii] gi|823251026|ref|XP_012458103.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium raimondii] gi|763810991|gb|KJB77893.1| hypothetical protein B456_012G163900 [Gossypium raimondii] Length = 54 Score = 85.9 bits (211), Expect = 1e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLS 252 MFPGMFM+KPDKAAALKQL+ HVAMFG WV V+RVTPYILHYLS Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPYILHYLS 44 >ref|XP_012458101.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium raimondii] gi|763810990|gb|KJB77892.1| hypothetical protein B456_012G163800 [Gossypium raimondii] Length = 54 Score = 85.9 bits (211), Expect = 1e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLS 252 MFPGMFM+KPDKAAALKQL+ HVAMFG WV V+RVTPYILHYLS Sbjct: 1 MFPGMFMRKPDKAAALKQLKAHVAMFGVWVAVVRVTPYILHYLS 44 >gb|KHG18108.1| Mitochondrial import receptor subunit TOM6 -like protein [Gossypium arboreum] Length = 76 Score = 85.9 bits (211), Expect = 1e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLS 252 MFPGMFM+KPDKAAALKQL+ HVAMFG WV V+RVTPYILHYLS Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPYILHYLS 44 >gb|KHF97675.1| Mitochondrial import receptor subunit TOM6 -like protein [Gossypium arboreum] Length = 93 Score = 85.9 bits (211), Expect = 1e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLS 252 MFPGMFM+KPDKAAALKQL+ HVAMFG WV V+RVTPYILHYLS Sbjct: 1 MFPGMFMRKPDKAAALKQLKAHVAMFGVWVAVVRVTPYILHYLS 44 >ref|XP_012069348.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Jatropha curcas] gi|643740610|gb|KDP46200.1| hypothetical protein JCGZ_10040 [Jatropha curcas] Length = 54 Score = 85.9 bits (211), Expect = 1e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLS 252 MFPGMFM+KPDKAAALKQL+THVAMFG WV V+RV PYILHYLS Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVAMFGVWVAVVRVAPYILHYLS 44 >ref|XP_007019163.1| Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] gi|508724491|gb|EOY16388.1| Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] Length = 54 Score = 85.9 bits (211), Expect = 1e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLS 252 MFPGMFM+KPDKAAALKQL+ HVAMFG WV V+RVTPYILHYLS Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPYILHYLS 44 >ref|XP_002313822.1| hypothetical protein POPTR_0009s11330g [Populus trichocarpa] gi|118483621|gb|ABK93705.1| unknown [Populus trichocarpa] gi|222850230|gb|EEE87777.1| hypothetical protein POPTR_0009s11330g [Populus trichocarpa] Length = 54 Score = 85.5 bits (210), Expect = 1e-14 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLS 252 MFPG+FMKKPDKA ALKQLR+HVAMFG WVVV+RVTPY+LHY+S Sbjct: 1 MFPGLFMKKPDKAEALKQLRSHVAMFGAWVVVLRVTPYVLHYIS 44 >ref|XP_003541100.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 1 [Glycine max] gi|255626599|gb|ACU13644.1| unknown [Glycine max] gi|734387577|gb|KHN25340.1| Mitochondrial import receptor subunit TOM6 like [Glycine soja] gi|947075691|gb|KRH24531.1| hypothetical protein GLYMA_12G047200 [Glycine max] Length = 54 Score = 85.1 bits (209), Expect = 2e-14 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYL 249 MFPGMFM+KPDKAAALKQL++H AMFGTWVVVIRVTPY+LH+L Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGTWVVVIRVTPYVLHFL 43 >ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] gi|118484423|gb|ABK94088.1| unknown [Populus trichocarpa] gi|222848371|gb|EEE85918.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] Length = 54 Score = 85.1 bits (209), Expect = 2e-14 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLS 252 MFPGMFM+KPDKA ALKQL++HVAMFG WVVV+RVTPY+LHYLS Sbjct: 1 MFPGMFMRKPDKAEALKQLKSHVAMFGAWVVVLRVTPYVLHYLS 44 >ref|XP_006590915.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Glycine max] gi|734329252|gb|KHN06159.1| Mitochondrial import receptor subunit TOM6 like [Glycine soja] gi|947080746|gb|KRH29535.1| hypothetical protein GLYMA_11G122300 [Glycine max] gi|947080747|gb|KRH29536.1| hypothetical protein GLYMA_11G122300 [Glycine max] Length = 54 Score = 84.7 bits (208), Expect = 2e-14 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLS 252 MFPGMFM+KPDKAAALKQL++H AMFG WVVVIRVTPY+LH+LS Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGAWVVVIRVTPYVLHFLS 44 >ref|XP_012836998.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Erythranthe guttatus] gi|848872878|ref|XP_012836999.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Erythranthe guttatus] Length = 54 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLS 252 MFPGMFM+KPDKAAALKQLR+H AMFG WV VIRV PYILHYLS Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHAAMFGAWVAVIRVAPYILHYLS 44 >ref|XP_009596562.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tomentosiformis] gi|698489778|ref|XP_009791420.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana sylvestris] Length = 54 Score = 84.3 bits (207), Expect = 3e-14 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLS 252 MFPG+FM+KPDKAAALKQL+THVA+FG WV VIRVTPYILHY S Sbjct: 1 MFPGLFMRKPDKAAALKQLKTHVALFGAWVAVIRVTPYILHYFS 44 >ref|XP_009618631.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tomentosiformis] Length = 54 Score = 84.3 bits (207), Expect = 3e-14 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLS 252 MFPG+FM+KPDKAAALKQL+THVA+FGTWV VIRV PYILHY S Sbjct: 1 MFPGLFMRKPDKAAALKQLKTHVALFGTWVAVIRVAPYILHYFS 44 >ref|XP_013456331.1| import receptor subunit TOM6-like protein [Medicago truncatula] gi|657388427|gb|KEH30362.1| import receptor subunit TOM6-like protein [Medicago truncatula] Length = 54 Score = 84.3 bits (207), Expect = 3e-14 Identities = 36/44 (81%), Positives = 43/44 (97%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLS 252 MFPGMFM+KPDKA ALKQL++HVAMFGTWV+VIR+TPYILH+L+ Sbjct: 1 MFPGMFMRKPDKAVALKQLKSHVAMFGTWVLVIRITPYILHFLN 44 >gb|EYU37743.1| hypothetical protein MIMGU_mgv1a016428mg [Erythranthe guttata] Length = 122 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = +1 Query: 121 MFPGMFMKKPDKAAALKQLRTHVAMFGTWVVVIRVTPYILHYLS 252 MFPGMFM+KPDKAAALKQLR+H AMFG WV VIRV PYILHYLS Sbjct: 69 MFPGMFMRKPDKAAALKQLRSHAAMFGAWVAVIRVAPYILHYLS 112