BLASTX nr result
ID: Zanthoxylum22_contig00032410
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00032410 (407 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24974.3| unnamed protein product [Vitis vinifera] 113 6e-23 ref|XP_003633566.1| PREDICTED: glutamine--fructose-6-phosphate a... 113 6e-23 ref|XP_008218463.1| PREDICTED: glutamine--fructose-6-phosphate a... 110 4e-22 ref|XP_008218462.1| PREDICTED: glutamine--fructose-6-phosphate a... 110 4e-22 ref|XP_007204967.1| hypothetical protein PRUPE_ppa002315mg [Prun... 110 4e-22 ref|XP_012460165.1| PREDICTED: glutamine--fructose-6-phosphate a... 110 5e-22 ref|XP_011091767.1| PREDICTED: glutamine--fructose-6-phosphate a... 110 5e-22 ref|XP_011088075.1| PREDICTED: glutamine--fructose-6-phosphate a... 110 5e-22 ref|XP_009340352.1| PREDICTED: glutamine--fructose-6-phosphate a... 110 5e-22 ref|XP_008355857.1| PREDICTED: glutamine--fructose-6-phosphate a... 110 5e-22 ref|XP_008345781.1| PREDICTED: glutamine--fructose-6-phosphate a... 110 5e-22 ref|XP_012085779.1| PREDICTED: glutamine--fructose-6-phosphate a... 110 5e-22 gb|KDO54020.1| hypothetical protein CISIN_1g0066592mg, partial [... 110 5e-22 ref|XP_002514829.1| glucosamine-fructose-6-phosphate aminotransf... 110 5e-22 ref|XP_012849748.1| PREDICTED: glutamine--fructose-6-phosphate a... 110 5e-22 ref|XP_006428622.1| hypothetical protein CICLE_v10011203mg [Citr... 110 5e-22 gb|KHG26614.1| Glucosamine--fructose-6-phosphate aminotransferas... 109 7e-22 gb|KHG26613.1| Glucosamine--fructose-6-phosphate aminotransferas... 109 7e-22 ref|XP_010244880.1| PREDICTED: glutamine--fructose-6-phosphate a... 109 7e-22 gb|EPS64523.1| hypothetical protein M569_10252 [Genlisea aurea] 109 7e-22 >emb|CBI24974.3| unnamed protein product [Vitis vinifera] Length = 758 Score = 113 bits (282), Expect = 6e-23 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -3 Query: 405 CPGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 CPGGSCRVIEVPQVEDCLQPV+N+VPLQLLAYHLTVLRGYNVDQPRNLAKSVTT Sbjct: 704 CPGGSCRVIEVPQVEDCLQPVINVVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 757 >ref|XP_003633566.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Vitis vinifera] Length = 684 Score = 113 bits (282), Expect = 6e-23 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -3 Query: 405 CPGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 CPGGSCRVIEVPQVEDCLQPV+N+VPLQLLAYHLTVLRGYNVDQPRNLAKSVTT Sbjct: 630 CPGGSCRVIEVPQVEDCLQPVINVVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 683 >ref|XP_008218463.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 isoform X2 [Prunus mume] Length = 606 Score = 110 bits (275), Expect = 4e-22 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -3 Query: 405 CPGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 CPGGSCRVIEVPQ+EDCLQPV+NIVPLQLLAYHLTVLRG+NVDQPRNLAKSVTT Sbjct: 552 CPGGSCRVIEVPQLEDCLQPVVNIVPLQLLAYHLTVLRGFNVDQPRNLAKSVTT 605 >ref|XP_008218462.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 isoform X1 [Prunus mume] Length = 688 Score = 110 bits (275), Expect = 4e-22 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -3 Query: 405 CPGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 CPGGSCRVIEVPQ+EDCLQPV+NIVPLQLLAYHLTVLRG+NVDQPRNLAKSVTT Sbjct: 634 CPGGSCRVIEVPQLEDCLQPVVNIVPLQLLAYHLTVLRGFNVDQPRNLAKSVTT 687 >ref|XP_007204967.1| hypothetical protein PRUPE_ppa002315mg [Prunus persica] gi|462400609|gb|EMJ06166.1| hypothetical protein PRUPE_ppa002315mg [Prunus persica] Length = 688 Score = 110 bits (275), Expect = 4e-22 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -3 Query: 405 CPGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 CPGGSCRVIEVPQ+EDCLQPV+NIVPLQLLAYHLTVLRG+NVDQPRNLAKSVTT Sbjct: 634 CPGGSCRVIEVPQLEDCLQPVVNIVPLQLLAYHLTVLRGFNVDQPRNLAKSVTT 687 >ref|XP_012460165.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like isoform X1 [Gossypium raimondii] gi|763808234|gb|KJB75136.1| hypothetical protein B456_012G026300 [Gossypium raimondii] gi|763808236|gb|KJB75138.1| hypothetical protein B456_012G026300 [Gossypium raimondii] gi|763808238|gb|KJB75140.1| hypothetical protein B456_012G026300 [Gossypium raimondii] Length = 695 Score = 110 bits (274), Expect = 5e-22 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -3 Query: 405 CPGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 CPGG CRVIEVPQVEDCLQPV+NIVP QLLAYHLTVLRGYNVDQPRNLAKSVTT Sbjct: 641 CPGGGCRVIEVPQVEDCLQPVVNIVPFQLLAYHLTVLRGYNVDQPRNLAKSVTT 694 >ref|XP_011091767.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like [Sesamum indicum] Length = 683 Score = 110 bits (274), Expect = 5e-22 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -3 Query: 405 CPGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 C GGSCRVIEVPQVEDCLQPV+NIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT Sbjct: 629 CVGGSCRVIEVPQVEDCLQPVINIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 682 >ref|XP_011088075.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like [Sesamum indicum] Length = 685 Score = 110 bits (274), Expect = 5e-22 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -3 Query: 405 CPGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 C GGSCRVIEVPQVEDCLQPV+NIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT Sbjct: 631 CVGGSCRVIEVPQVEDCLQPVINIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 684 >ref|XP_009340352.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like isoform X1 [Pyrus x bretschneideri] gi|694425216|ref|XP_009340353.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like isoform X2 [Pyrus x bretschneideri] gi|694425286|ref|XP_009340386.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like [Pyrus x bretschneideri] Length = 685 Score = 110 bits (274), Expect = 5e-22 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = -3 Query: 405 CPGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 CPGGSCRVIEVPQ+EDCLQPV+NI+PLQLLAYHLTVLRG+NVDQPRNLAKSVTT Sbjct: 631 CPGGSCRVIEVPQLEDCLQPVVNIIPLQLLAYHLTVLRGFNVDQPRNLAKSVTT 684 >ref|XP_008355857.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like [Malus domestica] Length = 685 Score = 110 bits (274), Expect = 5e-22 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = -3 Query: 405 CPGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 CPGGSCRVIEVPQ+EDCLQPV+NI+PLQLLAYHLTVLRG+NVDQPRNLAKSVTT Sbjct: 631 CPGGSCRVIEVPQLEDCLQPVVNIIPLQLLAYHLTVLRGFNVDQPRNLAKSVTT 684 >ref|XP_008345781.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like [Malus domestica] Length = 431 Score = 110 bits (274), Expect = 5e-22 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = -3 Query: 405 CPGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 CPGGSCRVIEVPQ+EDCLQPV+NI+PLQLLAYHLTVLRG+NVDQPRNLAKSVTT Sbjct: 377 CPGGSCRVIEVPQLEDCLQPVVNIIPLQLLAYHLTVLRGFNVDQPRNLAKSVTT 430 >ref|XP_012085779.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Jatropha curcas] gi|643714217|gb|KDP26882.1| hypothetical protein JCGZ_18040 [Jatropha curcas] Length = 697 Score = 110 bits (274), Expect = 5e-22 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -3 Query: 405 CPGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 CPG SCRVIEVPQVEDCLQPV+NIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT Sbjct: 643 CPGQSCRVIEVPQVEDCLQPVVNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 696 >gb|KDO54020.1| hypothetical protein CISIN_1g0066592mg, partial [Citrus sinensis] Length = 411 Score = 110 bits (274), Expect = 5e-22 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 402 PGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 PGGSCRVIEVPQVEDCLQPV+NIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT Sbjct: 358 PGGSCRVIEVPQVEDCLQPVINIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 410 >ref|XP_002514829.1| glucosamine-fructose-6-phosphate aminotransferase, putative [Ricinus communis] gi|223545880|gb|EEF47383.1| glucosamine-fructose-6-phosphate aminotransferase, putative [Ricinus communis] Length = 692 Score = 110 bits (274), Expect = 5e-22 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -3 Query: 405 CPGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 CPG SCRVIEVPQVEDCLQPV+NIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT Sbjct: 638 CPGESCRVIEVPQVEDCLQPVVNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 691 >ref|XP_012849748.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Erythranthe guttatus] gi|604314134|gb|EYU27021.1| hypothetical protein MIMGU_mgv1a002348mg [Erythranthe guttata] Length = 685 Score = 110 bits (274), Expect = 5e-22 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -3 Query: 405 CPGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 C GGSCRVIEVPQVEDCLQPV+NIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT Sbjct: 631 CVGGSCRVIEVPQVEDCLQPVINIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 684 >ref|XP_006428622.1| hypothetical protein CICLE_v10011203mg [Citrus clementina] gi|568853605|ref|XP_006480441.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like [Citrus sinensis] gi|557530679|gb|ESR41862.1| hypothetical protein CICLE_v10011203mg [Citrus clementina] Length = 691 Score = 110 bits (274), Expect = 5e-22 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 402 PGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 PGGSCRVIEVPQVEDCLQPV+NIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT Sbjct: 638 PGGSCRVIEVPQVEDCLQPVINIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 690 >gb|KHG26614.1| Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Gossypium arboreum] Length = 695 Score = 109 bits (273), Expect = 7e-22 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -3 Query: 405 CPGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 CPGG CRVIEVPQVEDCLQPV+NIVP QLLAYHLTVLRGYNVDQPRNLAKSVTT Sbjct: 641 CPGGGCRVIEVPQVEDCLQPVVNIVPCQLLAYHLTVLRGYNVDQPRNLAKSVTT 694 >gb|KHG26613.1| Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Gossypium arboreum] Length = 714 Score = 109 bits (273), Expect = 7e-22 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -3 Query: 405 CPGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 CPGG CRVIEVPQVEDCLQPV+NIVP QLLAYHLTVLRGYNVDQPRNLAKSVTT Sbjct: 641 CPGGGCRVIEVPQVEDCLQPVVNIVPCQLLAYHLTVLRGYNVDQPRNLAKSVTT 694 >ref|XP_010244880.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Nelumbo nucifera] Length = 692 Score = 109 bits (273), Expect = 7e-22 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -3 Query: 405 CPGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 CPGGSCRVIEVPQV DC+QPV+NIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT Sbjct: 638 CPGGSCRVIEVPQVVDCIQPVVNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 691 >gb|EPS64523.1| hypothetical protein M569_10252 [Genlisea aurea] Length = 684 Score = 109 bits (273), Expect = 7e-22 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = -3 Query: 405 CPGGSCRVIEVPQVEDCLQPVLNIVPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 244 C GGSCRVIEVPQVEDCLQPV+N++PLQLLAYHLTVLRGYNVDQPRNLAKSVTT Sbjct: 630 CAGGSCRVIEVPQVEDCLQPVINVIPLQLLAYHLTVLRGYNVDQPRNLAKSVTT 683