BLASTX nr result
ID: Zanthoxylum22_contig00032263
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00032263 (545 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006466050.1| PREDICTED: calcineurin B-like protein 9-like... 67 7e-09 ref|XP_006426514.1| hypothetical protein CICLE_v10026324mg [Citr... 67 7e-09 ref|XP_006426513.1| hypothetical protein CICLE_v10026324mg [Citr... 67 7e-09 ref|XP_006426512.1| hypothetical protein CICLE_v10026324mg [Citr... 67 7e-09 ref|XP_013444310.1| EF hand calcium-binding family protein [Medi... 64 4e-08 ref|XP_013444309.1| EF hand calcium-binding family protein [Medi... 64 4e-08 gb|ACJ84458.1| unknown [Medicago truncatula] 64 4e-08 gb|AFK42823.1| unknown [Medicago truncatula] 64 4e-08 gb|KCW81684.1| hypothetical protein EUGRSUZ_C03043 [Eucalyptus g... 64 6e-08 ref|XP_010667138.1| PREDICTED: calcineurin B-like protein 10 iso... 63 7e-08 gb|KRH44162.1| hypothetical protein GLYMA_08G194000 [Glycine max] 62 2e-07 gb|KFK29915.1| hypothetical protein AALP_AA7G194900 [Arabis alpina] 62 2e-07 ref|NP_001236411.1| uncharacterized protein LOC100306023 [Glycin... 62 2e-07 gb|KRH47137.1| hypothetical protein GLYMA_07G010800 [Glycine max] 61 3e-07 gb|KRH47135.1| hypothetical protein GLYMA_07G010800 [Glycine max] 61 3e-07 gb|KHN39297.1| Calcineurin B-like protein 10 [Glycine soja] 61 3e-07 ref|XP_008797765.1| PREDICTED: calcineurin B-like protein 9 isof... 61 3e-07 ref|XP_008797764.1| PREDICTED: calcineurin B-like protein 9 isof... 61 3e-07 sp|Q3HRN7.1|CNBLA_ORYSJ RecName: Full=Calcineurin B-like protein... 61 3e-07 ref|XP_006583018.1| PREDICTED: calcineurin B-like protein 10-lik... 61 3e-07 >ref|XP_006466050.1| PREDICTED: calcineurin B-like protein 9-like isoform X1 [Citrus sinensis] gi|568823290|ref|XP_006466051.1| PREDICTED: calcineurin B-like protein 9-like isoform X2 [Citrus sinensis] gi|641846417|gb|KDO65301.1| hypothetical protein CISIN_1g025241mg [Citrus sinensis] Length = 255 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 99 QVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 +VFDLFDEKKNGVIEFEEFVRALSIFHP TPLE Sbjct: 114 RVFDLFDEKKNGVIEFEEFVRALSIFHPSTPLE 146 >ref|XP_006426514.1| hypothetical protein CICLE_v10026324mg [Citrus clementina] gi|557528504|gb|ESR39754.1| hypothetical protein CICLE_v10026324mg [Citrus clementina] Length = 255 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 99 QVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 +VFDLFDEKKNGVIEFEEFVRALSIFHP TPLE Sbjct: 114 RVFDLFDEKKNGVIEFEEFVRALSIFHPSTPLE 146 >ref|XP_006426513.1| hypothetical protein CICLE_v10026324mg [Citrus clementina] gi|567867785|ref|XP_006426515.1| hypothetical protein CICLE_v10026324mg [Citrus clementina] gi|557528503|gb|ESR39753.1| hypothetical protein CICLE_v10026324mg [Citrus clementina] gi|557528505|gb|ESR39755.1| hypothetical protein CICLE_v10026324mg [Citrus clementina] Length = 184 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 99 QVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 +VFDLFDEKKNGVIEFEEFVRALSIFHP TPLE Sbjct: 114 RVFDLFDEKKNGVIEFEEFVRALSIFHPSTPLE 146 >ref|XP_006426512.1| hypothetical protein CICLE_v10026324mg [Citrus clementina] gi|557528502|gb|ESR39752.1| hypothetical protein CICLE_v10026324mg [Citrus clementina] Length = 220 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 99 QVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 +VFDLFDEKKNGVIEFEEFVRALSIFHP TPLE Sbjct: 114 RVFDLFDEKKNGVIEFEEFVRALSIFHPSTPLE 146 >ref|XP_013444310.1| EF hand calcium-binding family protein [Medicago truncatula] gi|657372469|gb|KEH18337.1| EF hand calcium-binding family protein [Medicago truncatula] Length = 257 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 99 QVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 +VFDLFDEKKNGVIEFEEFV ALS+FHP TPLE Sbjct: 119 RVFDLFDEKKNGVIEFEEFVHALSVFHPYTPLE 151 >ref|XP_013444309.1| EF hand calcium-binding family protein [Medicago truncatula] gi|657372468|gb|KEH18336.1| EF hand calcium-binding family protein [Medicago truncatula] Length = 219 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 99 QVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 +VFDLFDEKKNGVIEFEEFV ALS+FHP TPLE Sbjct: 100 RVFDLFDEKKNGVIEFEEFVHALSVFHPYTPLE 132 >gb|ACJ84458.1| unknown [Medicago truncatula] Length = 232 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 99 QVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 +VFDLFDEKKNGVIEFEEFV ALS+FHP TPLE Sbjct: 119 RVFDLFDEKKNGVIEFEEFVHALSVFHPYTPLE 151 >gb|AFK42823.1| unknown [Medicago truncatula] Length = 257 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 99 QVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 +VFDLFDEKKNGVIEFEEFV ALS+FHP TPLE Sbjct: 119 RVFDLFDEKKNGVIEFEEFVHALSVFHPYTPLE 151 >gb|KCW81684.1| hypothetical protein EUGRSUZ_C03043 [Eucalyptus grandis] Length = 318 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 108 NSFQVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 N F VFDLFDEKKNGVIEFEEFV ALS+FHP P+E Sbjct: 179 NLFLVFDLFDEKKNGVIEFEEFVHALSVFHPYAPVE 214 >ref|XP_010667138.1| PREDICTED: calcineurin B-like protein 10 isoform X1 [Beta vulgaris subsp. vulgaris] Length = 289 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 105 SFQVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 S QVFD+FDEKKNGVIEFEEF+ ALS+FHP P+E Sbjct: 136 SIQVFDIFDEKKNGVIEFEEFIHALSVFHPYAPIE 170 >gb|KRH44162.1| hypothetical protein GLYMA_08G194000 [Glycine max] Length = 265 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 99 QVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 +VFD+FDEK+NGVIEFEEFV ALSIFHP TPLE Sbjct: 116 RVFDVFDEKRNGVIEFEEFVHALSIFHPCTPLE 148 >gb|KFK29915.1| hypothetical protein AALP_AA7G194900 [Arabis alpina] Length = 248 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 99 QVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 +VFDLFDEKKNGVIEFEEF+ ALS+FHP P+E Sbjct: 112 RVFDLFDEKKNGVIEFEEFIHALSVFHPNAPIE 144 >ref|NP_001236411.1| uncharacterized protein LOC100306023 [Glycine max] gi|255627309|gb|ACU13999.1| unknown [Glycine max] gi|734347230|gb|KHN11293.1| Calcineurin B-like protein 10 [Glycine soja] gi|947095576|gb|KRH44161.1| hypothetical protein GLYMA_08G194000 [Glycine max] Length = 261 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 99 QVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 +VFD+FDEK+NGVIEFEEFV ALSIFHP TPLE Sbjct: 116 RVFDVFDEKRNGVIEFEEFVHALSIFHPCTPLE 148 >gb|KRH47137.1| hypothetical protein GLYMA_07G010800 [Glycine max] Length = 178 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 99 QVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 +VFD+FDEK+NG+IEFEEFV ALSIFHP TPLE Sbjct: 116 RVFDVFDEKRNGIIEFEEFVHALSIFHPCTPLE 148 >gb|KRH47135.1| hypothetical protein GLYMA_07G010800 [Glycine max] Length = 236 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 99 QVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 +VFD+FDEK+NG+IEFEEFV ALSIFHP TPLE Sbjct: 116 RVFDVFDEKRNGIIEFEEFVHALSIFHPCTPLE 148 >gb|KHN39297.1| Calcineurin B-like protein 10 [Glycine soja] Length = 259 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 99 QVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 +VFD+FDEK+NG+IEFEEFV ALSIFHP TPLE Sbjct: 112 RVFDVFDEKRNGIIEFEEFVHALSIFHPCTPLE 144 >ref|XP_008797765.1| PREDICTED: calcineurin B-like protein 9 isoform X2 [Phoenix dactylifera] Length = 253 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 99 QVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 +VFDLFDEKKNGVIEFEEF+ ALS+FHP PL+ Sbjct: 117 RVFDLFDEKKNGVIEFEEFIHALSVFHPNAPLD 149 >ref|XP_008797764.1| PREDICTED: calcineurin B-like protein 9 isoform X1 [Phoenix dactylifera] Length = 255 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 99 QVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 +VFDLFDEKKNGVIEFEEF+ ALS+FHP PL+ Sbjct: 119 RVFDLFDEKKNGVIEFEEFIHALSVFHPNAPLD 151 >sp|Q3HRN7.1|CNBLA_ORYSJ RecName: Full=Calcineurin B-like protein 10 gi|76577805|gb|ABA54185.1| calcineurin B-like protein 10 [Oryza sativa Japonica Group] gi|937898005|dbj|BAS73985.1| Os01g0711500 [Oryza sativa Japonica Group] Length = 266 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 99 QVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 +VFDLFDEKKN VIEFEEF+ A+S+FHP TPLE Sbjct: 130 RVFDLFDEKKNSVIEFEEFIHAISVFHPNTPLE 162 >ref|XP_006583018.1| PREDICTED: calcineurin B-like protein 10-like isoform X2 [Glycine max] gi|947098644|gb|KRH47136.1| hypothetical protein GLYMA_07G010800 [Glycine max] Length = 203 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 99 QVFDLFDEKKNGVIEFEEFVRALSIFHPRTPLE 1 +VFD+FDEK+NG+IEFEEFV ALSIFHP TPLE Sbjct: 116 RVFDVFDEKRNGIIEFEEFVHALSIFHPCTPLE 148