BLASTX nr result
ID: Zanthoxylum22_contig00032256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00032256 (508 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO49547.1| hypothetical protein CISIN_1g036613mg [Citrus sin... 60 5e-07 ref|XP_006422759.1| hypothetical protein CICLE_v10029832mg [Citr... 60 5e-07 >gb|KDO49547.1| hypothetical protein CISIN_1g036613mg [Citrus sinensis] Length = 347 Score = 60.5 bits (145), Expect = 5e-07 Identities = 41/73 (56%), Positives = 51/73 (69%), Gaps = 10/73 (13%) Frame = +1 Query: 319 EPFKLSTYLSER*NSMKMLSSVNGEDDDGCSLRNCSNNLKETCSSSL---------RTLK 471 EPFKLSTYLSER NS+K SS NGE++ SL N + N KE+CS +L R+LK Sbjct: 23 EPFKLSTYLSERRNSLKK-SSSNGENNS--SLGNHTCNPKESCSLTLRKKHVLHSPRSLK 79 Query: 472 S-MYKLISPNQKQ 507 S +YKLI+PN+KQ Sbjct: 80 SLLYKLITPNEKQ 92 >ref|XP_006422759.1| hypothetical protein CICLE_v10029832mg [Citrus clementina] gi|557524693|gb|ESR35999.1| hypothetical protein CICLE_v10029832mg [Citrus clementina] Length = 163 Score = 60.5 bits (145), Expect = 5e-07 Identities = 41/73 (56%), Positives = 51/73 (69%), Gaps = 10/73 (13%) Frame = +1 Query: 319 EPFKLSTYLSER*NSMKMLSSVNGEDDDGCSLRNCSNNLKETCSSSL---------RTLK 471 EPFKLSTYLSER NS+K SS NGE++ SL N + N KE+CS +L R+LK Sbjct: 23 EPFKLSTYLSERRNSLKK-SSSNGENNS--SLGNHTCNPKESCSLTLRKKHVLYSPRSLK 79 Query: 472 S-MYKLISPNQKQ 507 S +YKLI+PN+KQ Sbjct: 80 SLLYKLITPNEKQ 92