BLASTX nr result
ID: Zanthoxylum22_contig00031950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00031950 (409 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006476304.1| PREDICTED: uncharacterized protein LOC102613... 72 2e-10 ref|XP_006439239.1| hypothetical protein CICLE_v10021806mg [Citr... 70 5e-10 ref|XP_006439238.1| hypothetical protein CICLE_v10021806mg [Citr... 70 5e-10 >ref|XP_006476304.1| PREDICTED: uncharacterized protein LOC102613166 [Citrus sinensis] Length = 255 Score = 72.0 bits (175), Expect = 2e-10 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = -2 Query: 156 YDHPHCKILNLCKKKNRLNDRGICRAELSNDAPFVIAIGTCMLSSLVLATPA 1 Y+ H +ILN K+K +L RG CRAE S+DAPFVIAIGTCMLSSLVLATPA Sbjct: 30 YNPTHYRILN--KRKMKLKHRGTCRAEFSDDAPFVIAIGTCMLSSLVLATPA 79 >ref|XP_006439239.1| hypothetical protein CICLE_v10021806mg [Citrus clementina] gi|557541501|gb|ESR52479.1| hypothetical protein CICLE_v10021806mg [Citrus clementina] Length = 254 Score = 70.5 bits (171), Expect = 5e-10 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = -2 Query: 156 YDHPHCKILNLCKKKNRLNDRGICRAELSNDAPFVIAIGTCMLSSLVLATPA 1 Y+ H +ILN K+K +L RG CRAE S+DAPFVIAIGTCMLSSLVLA+PA Sbjct: 30 YNPTHYRILN--KRKMKLKHRGTCRAEFSDDAPFVIAIGTCMLSSLVLASPA 79 >ref|XP_006439238.1| hypothetical protein CICLE_v10021806mg [Citrus clementina] gi|557541500|gb|ESR52478.1| hypothetical protein CICLE_v10021806mg [Citrus clementina] Length = 255 Score = 70.5 bits (171), Expect = 5e-10 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = -2 Query: 156 YDHPHCKILNLCKKKNRLNDRGICRAELSNDAPFVIAIGTCMLSSLVLATPA 1 Y+ H +ILN K+K +L RG CRAE S+DAPFVIAIGTCMLSSLVLA+PA Sbjct: 30 YNPTHYRILN--KRKMKLKHRGTCRAEFSDDAPFVIAIGTCMLSSLVLASPA 79