BLASTX nr result
ID: Zanthoxylum22_contig00031892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00031892 (255 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003587363.1| ribosomal protein L2 [Cucurbita pepo] gi|259... 63 1e-07 ref|YP_003587229.1| ribosomal protein L2 [Citrullus lanatus] gi|... 63 1e-07 ref|YP_002608204.1| ribosomal protein L2 [Carica papaya] gi|1705... 63 1e-07 ref|YP_002608368.1| ribosomal protein L2 [Vitis vinifera] gi|209... 63 1e-07 ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccin... 63 1e-07 emb|CAN61455.1| hypothetical protein VITISV_029794 [Vitis vinifera] 63 1e-07 ref|YP_009045801.1| ribosomal protein L2 (mitochondrion) [Batis ... 62 1e-07 ref|YP_009173847.1| ribosomal protein L2 (mitochondrion) [Populu... 61 3e-07 ref|XP_006422248.1| hypothetical protein CICLE_v10005397mg [Citr... 61 3e-07 ref|XP_006422247.1| hypothetical protein CICLE_v10005397mg [Citr... 61 3e-07 gb|KRH49362.1| hypothetical protein GLYMA_07G149000 [Glycine max] 60 5e-07 ref|XP_003532340.1| PREDICTED: 60S ribosomal protein L2, mitocho... 60 5e-07 ref|XP_014496635.1| PREDICTED: 60S ribosomal protein L2, mitocho... 60 8e-07 gb|ALF04062.1| ribosomal protein L2 (mitochondrion) [Cannabis sa... 60 8e-07 gb|KOM28501.1| hypothetical protein LR48_Vigan549s005600 [Vigna ... 60 8e-07 ref|YP_003433878.1| ribosomal protein large subunit 2 (mitochond... 60 8e-07 ref|YP_514664.1| ribosomal protein L2 (mitochondrion) [Oryza sat... 60 8e-07 sp|P92812.2|RM02_ORYSJ RecName: Full=60S ribosomal protein L2, m... 60 8e-07 gb|AEK66742.1| ribosomal protein L2 (mitochondrion) [Ferrocalamu... 60 8e-07 ref|YP_005090371.1| ribosomal protein L2 (mitochondrion) [Phoeni... 60 8e-07 >ref|YP_003587363.1| ribosomal protein L2 [Cucurbita pepo] gi|259156826|gb|ACV96687.1| ribosomal protein L2 [Cucurbita pepo] Length = 332 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 112 MSQSHVGRALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 M QS GRALRQFT GKSAGRNS+GRIT+FHRGGG Sbjct: 1 MRQSQEGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 37 >ref|YP_003587229.1| ribosomal protein L2 [Citrullus lanatus] gi|259156783|gb|ACV96645.1| ribosomal protein L2 [Citrullus lanatus] Length = 332 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 112 MSQSHVGRALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 M QS GRALRQFT GKSAGRNS+GRIT+FHRGGG Sbjct: 1 MRQSQEGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 37 >ref|YP_002608204.1| ribosomal protein L2 [Carica papaya] gi|170522383|gb|ACB20493.1| ribosomal protein L2 (mitochondrion) [Carica papaya] Length = 335 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 112 MSQSHVGRALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 M QS GRALRQFT GKSAGRNS+GRIT+FHRGGG Sbjct: 1 MRQSQEGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 37 >ref|YP_002608368.1| ribosomal protein L2 [Vitis vinifera] gi|209954165|emb|CAQ77612.1| ribosomal protein L2 [Vitis vinifera] gi|239764759|gb|ACS15228.1| ribosomal protein L2 [Vitis vinifera] Length = 334 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 112 MSQSHVGRALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 M QS GRALRQFT GKSAGRNS+GRIT+FHRGGG Sbjct: 1 MRQSQEGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 37 >ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] gi|549531664|gb|AGX28803.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] Length = 335 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 112 MSQSHVGRALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 M QS GRALRQFT GKSAGRNS+GRIT+FHRGGG Sbjct: 1 MRQSQEGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 37 >emb|CAN61455.1| hypothetical protein VITISV_029794 [Vitis vinifera] Length = 336 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 112 MSQSHVGRALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 M QS GRALRQFT GKSAGRNS+GRIT+FHRGGG Sbjct: 1 MRQSQEGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 37 >ref|YP_009045801.1| ribosomal protein L2 (mitochondrion) [Batis maritima] gi|655168575|gb|AIC83404.1| ribosomal protein L2 (mitochondrion) (mitochondrion) [Batis maritima] Length = 338 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 112 MSQSHVGRALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 M QS GRALRQFT GKSAGRNS+GRIT+FHRGGG Sbjct: 1 MRQSKEGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 37 >ref|YP_009173847.1| ribosomal protein L2 (mitochondrion) [Populus tremula] gi|948299279|ref|YP_009178744.1| ribosomal protein L2 (mitochondrion) [Populus tremula x Populus alba] gi|743913265|ref|XP_011000535.1| PREDICTED: 60S ribosomal protein L2, mitochondrial [Populus euphratica] gi|936227477|gb|ALH07311.1| ribosomal protein L2 (mitochondrion) [Populus tremula] gi|938485548|gb|ALJ49767.1| ribosomal protein L2 (mitochondrion) [Populus tremula x Populus alba] Length = 335 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 112 MSQSHVGRALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 M QS GRALRQFT GKSAGRNS+GRIT+FHRGGG Sbjct: 1 MRQSQEGRALRQFTSRTGKSAGRNSSGRITVFHRGGG 37 >ref|XP_006422248.1| hypothetical protein CICLE_v10005397mg [Citrus clementina] gi|568842841|ref|XP_006475340.1| PREDICTED: 60S ribosomal protein L2, mitochondrial-like [Citrus sinensis] gi|557524121|gb|ESR35488.1| hypothetical protein CICLE_v10005397mg [Citrus clementina] Length = 332 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 91 RALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 RALRQFT GKGKSAGRNS+GRITIFHRGGG Sbjct: 14 RALRQFTLGKGKSAGRNSSGRITIFHRGGG 43 >ref|XP_006422247.1| hypothetical protein CICLE_v10005397mg [Citrus clementina] gi|557524120|gb|ESR35487.1| hypothetical protein CICLE_v10005397mg [Citrus clementina] Length = 326 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 91 RALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 RALRQFT GKGKSAGRNS+GRITIFHRGGG Sbjct: 8 RALRQFTLGKGKSAGRNSSGRITIFHRGGG 37 >gb|KRH49362.1| hypothetical protein GLYMA_07G149000 [Glycine max] Length = 446 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 103 SHVGRALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 S V RALRQFTFG GK+AGRNSAGRIT FHRGGG Sbjct: 2 SGVKRALRQFTFGTGKTAGRNSAGRITSFHRGGG 35 >ref|XP_003532340.1| PREDICTED: 60S ribosomal protein L2, mitochondrial-like [Glycine max] gi|947098339|gb|KRH46924.1| hypothetical protein GLYMA_08G365200 [Glycine max] Length = 204 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 103 SHVGRALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 S V RALRQFTFG GK+AGRNSAGRIT FHRGGG Sbjct: 2 SGVKRALRQFTFGTGKTAGRNSAGRITSFHRGGG 35 >ref|XP_014496635.1| PREDICTED: 60S ribosomal protein L2, mitochondrial [Vigna radiata var. radiata] Length = 209 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 103 SHVGRALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 S V RALRQFTFG GK+AGRNS+GRIT FHRGGG Sbjct: 2 SGVKRALRQFTFGSGKTAGRNSSGRITSFHRGGG 35 >gb|ALF04062.1| ribosomal protein L2 (mitochondrion) [Cannabis sativa] Length = 337 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 112 MSQSHVGRALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 M QS RALRQFT GKSAGRNS+GRIT+FHRGGG Sbjct: 1 MRQSQEERALRQFTLSTGKSAGRNSSGRITVFHRGGG 37 >gb|KOM28501.1| hypothetical protein LR48_Vigan549s005600 [Vigna angularis] Length = 209 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 103 SHVGRALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 S V RALRQFTFG GK+AGRNS+GRIT FHRGGG Sbjct: 2 SGVKRALRQFTFGSGKTAGRNSSGRITSFHRGGG 35 >ref|YP_003433878.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza rufipogon] gi|285026149|dbj|BAI67982.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza rufipogon] gi|285026205|dbj|BAI68037.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza sativa Indica Group] Length = 504 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 112 MSQSHVGRALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 M QS GRALR FT GKSAGRNS+GRIT+FHRGGG Sbjct: 1 MRQSIKGRALRHFTLSTGKSAGRNSSGRITVFHRGGG 37 >ref|YP_514664.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|194033244|ref|YP_002000581.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] gi|23495405|dbj|BAC19886.1| Ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] gi|74100083|gb|AAZ99247.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|74100138|gb|AAZ99301.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] gi|74100192|gb|AAZ99354.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] gi|353685231|gb|AER12994.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|353685298|gb|AER13060.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|374277621|gb|AEZ03727.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|374277672|gb|AEZ03777.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|528540449|dbj|BAN67503.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza rufipogon] gi|528540486|dbj|BAN67539.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza rufipogon] Length = 502 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 112 MSQSHVGRALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 M QS GRALR FT GKSAGRNS+GRIT+FHRGGG Sbjct: 1 MRQSIKGRALRHFTLSTGKSAGRNSSGRITVFHRGGG 37 >sp|P92812.2|RM02_ORYSJ RecName: Full=60S ribosomal protein L2, mitochondrial gi|218547415|sp|P0C8K6.1|RM02_ORYSA RecName: Full=60S ribosomal protein L2, mitochondrial gi|218551750|sp|Q2F969.2|RM02_ORYSI RecName: Full=60S ribosomal protein L2, mitochondrial gi|193240423|dbj|BAA11350.2| ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] Length = 502 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 112 MSQSHVGRALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 M QS GRALR FT GKSAGRNS+GRIT+FHRGGG Sbjct: 1 MRQSIKGRALRHFTLSTGKSAGRNSSGRITVFHRGGG 37 >gb|AEK66742.1| ribosomal protein L2 (mitochondrion) [Ferrocalamus rimosivaginus] Length = 345 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 112 MSQSHVGRALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 M QS GRALR FT GKSAGRNS+GRIT+FHRGGG Sbjct: 1 MRQSIKGRALRHFTLSTGKSAGRNSSGRITVFHRGGG 37 >ref|YP_005090371.1| ribosomal protein L2 (mitochondrion) [Phoenix dactylifera] gi|343478424|gb|AEM43912.1| ribosomal protein L2 (mitochondrion) [Phoenix dactylifera] Length = 558 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 112 MSQSHVGRALRQFTFGKGKSAGRNSAGRITIFHRGGG 2 M QS GRALR FT GKSAGRNS+GRIT+FHRGGG Sbjct: 1 MRQSLKGRALRHFTLNTGKSAGRNSSGRITVFHRGGG 37