BLASTX nr result
ID: Zanthoxylum22_contig00031830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00031830 (311 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616777.1| hypothetical protein MTR_5g084150 [Medicago ... 87 5e-15 ref|NP_054927.1| hypothetical protein SpolCp017 [Spinacia olerac... 62 2e-07 gb|AFK48586.1| unknown [Medicago truncatula] 58 3e-06 >ref|XP_003616777.1| hypothetical protein MTR_5g084150 [Medicago truncatula] gi|355518112|gb|AES99735.1| hypothetical protein MTR_5g084150 [Medicago truncatula] Length = 187 Score = 87.0 bits (214), Expect = 5e-15 Identities = 46/84 (54%), Positives = 49/84 (58%) Frame = -2 Query: 253 FWKTKGVISFHGGAANYWAELDLNQRRHIANEFTVRPH*PLGHRPRKNQV*AYL*STINF 74 F TK VIS HGG+ N+WAELDLNQRRHIANEFT Sbjct: 5 FKNTKWVISLHGGSVNFWAELDLNQRRHIANEFT-------------------------- 38 Query: 73 LS*YPTPRGSRIPAASLKERCPEP 2 YPTPRGSRIP ASLKERCP+P Sbjct: 39 ---YPTPRGSRIPVASLKERCPKP 59 >ref|NP_054927.1| hypothetical protein SpolCp017 [Spinacia oleracea] gi|7636100|emb|CAB88720.1| hypothetical protein (chloroplast) [Spinacia oleracea] Length = 83 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 125 MPERLMGTDCKFVGNMSTLVQIQLGPIIRCSTMK 226 MPERLMGTDCKFVGNMSTLVQIQLGPII S ++ Sbjct: 1 MPERLMGTDCKFVGNMSTLVQIQLGPIISSSIIE 34 >gb|AFK48586.1| unknown [Medicago truncatula] Length = 29 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +2 Query: 125 MPERLMGTDCKFVGNMSTLVQIQLGPII 208 MPERLMGTDCKFVGNMSTLVQIQLGP I Sbjct: 1 MPERLMGTDCKFVGNMSTLVQIQLGPKI 28