BLASTX nr result
ID: Zanthoxylum22_contig00031814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00031814 (283 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006421013.1| hypothetical protein CICLE_v10006377mg [Citr... 77 4e-12 ref|XP_003629607.2| hypothetical protein MTR_8g081570 [Medicago ... 50 6e-06 ref|XP_002531080.1| nutrient reservoir, putative [Ricinus commun... 56 9e-06 >ref|XP_006421013.1| hypothetical protein CICLE_v10006377mg [Citrus clementina] gi|557522886|gb|ESR34253.1| hypothetical protein CICLE_v10006377mg [Citrus clementina] Length = 71 Score = 77.4 bits (189), Expect = 4e-12 Identities = 39/59 (66%), Positives = 42/59 (71%) Frame = +3 Query: 105 YPGGGNGKQRDIARNL*NRKVGSFYKPKSLFYFPVRLFQHRNRPETMTLSIHHVLAIIS 281 YPGGGNGKQRDIA+N +K F K KSL YFPV LFQ RN P TM LS+HHV IS Sbjct: 7 YPGGGNGKQRDIAQNAGIQKANIFDKRKSLNYFPVALFQERNEPVTMLLSMHHVPTFIS 65 >ref|XP_003629607.2| hypothetical protein MTR_8g081570 [Medicago truncatula] gi|657375247|gb|AET04083.2| hypothetical protein MTR_8g081570 [Medicago truncatula] Length = 583 Score = 50.4 bits (119), Expect(2) = 6e-06 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -1 Query: 142 AMSRCFPFPPPGYDKKTRIEDTDLL 68 AMSRCFPFPPPGY+KKTR ++ DLL Sbjct: 24 AMSRCFPFPPPGYEKKTRTDEVDLL 48 Score = 26.2 bits (56), Expect(2) = 6e-06 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -3 Query: 263 MVYGQGHSLWSVSVLEQ 213 MV+GQ HS W V LEQ Sbjct: 1 MVHGQEHSCWFVPFLEQ 17 >ref|XP_002531080.1| nutrient reservoir, putative [Ricinus communis] gi|223529326|gb|EEF31294.1| nutrient reservoir, putative [Ricinus communis] Length = 518 Score = 56.2 bits (134), Expect = 9e-06 Identities = 31/70 (44%), Positives = 34/70 (48%) Frame = -1 Query: 277 MIARTWCMDKVIVSGLFLCWNKRTGK*KRLFGL*KDPTFLFQRLRAMSRCFPFPPPGYDK 98 M ARTWCMDK I+SG MSRCFPFP PGY+K Sbjct: 1 MTARTWCMDKSILSGSL----------------------------EMSRCFPFPRPGYEK 32 Query: 97 KTRIEDTDLL 68 K R +DTDLL Sbjct: 33 KPRTDDTDLL 42