BLASTX nr result
ID: Zanthoxylum22_contig00031768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00031768 (280 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P14725.1|LAV1_PHYPO RecName: Full=Plasmodial-specific protein... 59 1e-06 >sp|P14725.1|LAV1_PHYPO RecName: Full=Plasmodial-specific protein LAV1-2 gi|3210|emb|CAA32655.1| unnamed protein product [Physarum polycephalum] Length = 355 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/61 (45%), Positives = 39/61 (63%) Frame = -1 Query: 256 SWNNVDSELDQIIAIAASLKGSVGGVKIQIDAVLQEKEAKTKQIHSEIESIQAKLESNTV 77 +WN VDS LD+II+IAASLK G VK L ++EA K++H +E +Q KL+ + Sbjct: 6 AWNPVDSSLDEIISIAASLKSKTGAVKEIFSQELTQREANVKKVHENLEELQKKLDHTSF 65 Query: 76 A 74 A Sbjct: 66 A 66